Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Exendin 4 (4-39) - (Hormones)

Product Specifications

Sequence

H-GTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mrto4 (NM_001106697) Rat Tagged ORF Clone Lentiviral Particle
RR208380L3V 200 µL

Mrto4 (NM_001106697) Rat Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Mouse Anti-Human IgM ascites Secondary Antibody
MF-0011464 1 mL

Mouse Anti-Human IgM ascites Secondary Antibody

Sign In for Pricing
View Details
PAK5/6
403391-01 50 µL

PAK5/6

Sign In for Pricing
View Details
PAK5/6
403391-02 100 µL

PAK5/6

Sign In for Pricing
View Details
Methyl 2-amino-5-chloropyridine-3-carboxylate
454832-01 100 mg

Methyl 2-amino-5-chloropyridine-3-carboxylate

Sign In for Pricing
View Details
Methyl 2-amino-5-chloropyridine-3-carboxylate
454832-02 250 mg

Methyl 2-amino-5-chloropyridine-3-carboxylate

Sign In for Pricing
View Details