Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CRB1 Antibody

Crumbs homolog 1 is a protein that in humans is encoded by the CRB1 gene. This gene encodes a protein which is similar to the Drosophila crumbs protein and localizes to the inner segment of mammalian photoreceptors. In Drosophila crumbs localizes to the stalk of the fly photoreceptor and may be a component of the molecular scaffold that controls proper development of polarity in the eye. Mutations in this gene are associated with a severe form of retinitis pigmentosa, RP12, and with Leber congenital amaurosis. Alternate splicing results in multiple transcript variants, some protein coding and some non-protein coding.

Product Specifications

Specifications

Western blot: 0.5-1 µg/mL, Immunohistochemistry (FFPE) : 1-2 µg/mL, Flow cytometry: 1-3ug/million cells

UniProt

P82279

Host

Rabbit

Reactivity

Human, Mouse, Rat

Immunogen

Amino acids FRTRDANVIILHAEKEPEFLNISIQDSRLFFQLQ from the human protein were used as the immunogen for the CRB1 antibody.

Clonality

Polyclonal

Isotype

IgG

Applications

WB, IHC-P, FACS

Purity

Affinity purified

Format

Antigen affinity purified

Buffer

Lyophilized from 1X PBS with 2% Trehalose and 0.025% sodium azide

Limitations

This CRB1 antibody is available for research use only.

Storage Conditions

Store the CRB1 antibody at -20°C.

Formulation

0.5 mg/mL if reconstituted with 0.2ml sterile DI water

Applications Notes

Optimal dilution of the CRB1 antibody should be determined by the researcher.

Image Legend

Western blot testing of human 1) HEK293 and 2) U-87 MG cell lysate with CRB1 antibody. Predicted molecular weight ~154 kDa.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human DAP12 MAb (Clone 406209)
MAB52401-100 100 µg

Human DAP12 MAb (Clone 406209)

Sign In for Pricing
View Details
Antimony (III) selenide
IN1135 1 Each

Antimony (III) selenide

Sign In for Pricing
View Details
SLC4A8 (Electroneutral Sodium Bicarbonate Exchanger 1, Electroneutral Na(+)-Driven Cl-HCO3 Exchanger, Solute Carrier Family 4 Member 8, k-NBC3, KIAA0739, NBC, NBC3, NDCBE1) (Azide Free) (MaxLight 550)
MBS6209812-01 0.1 mL

SLC4A8 (Electroneutral Sodium Bicarbonate Exchanger 1, Electroneutral Na(+)-Driven Cl-HCO3 Exchanger, Solute Carrier Family 4 Member 8, k-NBC3, KIAA0739, NBC, NBC3, NDCBE1) (Azide Free) (MaxLight 550)

Sign In for Pricing
View Details
SLC4A8 (Electroneutral Sodium Bicarbonate Exchanger 1, Electroneutral Na(+)-Driven Cl-HCO3 Exchanger, Solute Carrier Family 4 Member 8, k-NBC3, KIAA0739, NBC, NBC3, NDCBE1) (Azide Free) (MaxLight 550)
MBS6209812-02 5x 0.1 mL

SLC4A8 (Electroneutral Sodium Bicarbonate Exchanger 1, Electroneutral Na(+)-Driven Cl-HCO3 Exchanger, Solute Carrier Family 4 Member 8, k-NBC3, KIAA0739, NBC, NBC3, NDCBE1) (Azide Free) (MaxLight 550)

Sign In for Pricing
View Details
TXNDC5 Antibody
orb1320284 100 µL

TXNDC5 Antibody

Sign In for Pricing
View Details
H3FT (HIST3H3) Rabbit Polyclonal Antibody
TA327348 100 µL

H3FT (HIST3H3) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details