PPAR-gamma, Human (P37231-2, His)
Product Specifications
UNSPSC Description
The PPAR gamma protein is a nuclear receptor that binds to peroxisome proliferators and is activated upon ligand binding to specific PPREs on DNA. It regulates target gene transcription and controls fatty acid metabolism. PPAR-gamma Protein, Human (P37231-2, His) is the recombinant human-derived PPAR-gamma protein, expressed by E. coli , with C-6*His labeled tag.
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/ppar-gamma-protein-human-271aa-his.html
Purity
92.00
Smiles
ESADLRALAKHLYDSYIKSFPLTKAKARAILTGKTTDKSPFVIYDMNSLMMGEDKIKFKHITPLQEQSKEVAIRIFQGCQFRSVEAVQEITEYAKSIPGFVNLDLNDQVTLLKYGVHEIIYTMLASLMNKDGVLISEGQGFMTREFLKSLRKPFGDFMEPKFEFAVKFNALELDDSDLAIFIAVIILSGDRPGLLNVKPIEDIQDNLLQALELQLKLNHPESSQLFAKLLQKMTDLRQIVTEHVQLLQVIKKTETDMSLHPLLQEIYKDLY
Molecular Weight
Approximately 31 kDa
Shipping Conditions
Blue Ice
Storage Conditions
Stored at -20°C for 2 years
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC941037-100 1x 100 µL
CD44 Standard (DF1485), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC940965-500 1x 500 µL
MUC1 / CA15-3 / EMA / CD227 (Epithelial Marker) (VU-11D1), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC740226-100 1x 100 µL
Pmel17 / gp100 / SILV (NKI-beteb), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC402056-500 1x 500 µL
CD7 (T-Cell Leukemia Marker) (CD7/3737), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details