Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RCN3, Human (HEK293, His)

The RCN3 protein is a possible molecular chaperone that contributes to endoplasmic reticulum protein biosynthesis and transport. RCN3 is critical for pulmonary surfactant homeostasis and is required for the correct biosynthesis and transport of SP-A, SP-D, and ABCA3. RCN3 Protein, Human (HEK293, His) is the recombinant human-derived RCN3 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

RCN3 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/rcn3-protein-human-hek-293-his.html

Purity

95.0

Smiles

KPSPDAGPHGQGRVHQAAPLSDAPHDDAHGNFQYDHEAFLGREVAKEFDQLTPEESQARLGRIVDRMDRAGDGDGWVSLAELRAWIAHTQQRHIRDSVSAAWDTYDTDRDGRVGWEELRNATYGHYAPGEEFHDVEDAETYKKMLARDERRFRVADQDGDSMATREELTAFLHPEEFPHMRDIVIAETLEDLDRNKDGYVQVEEYIADLYSAEPGEEEPAWVQTERQQFRDFRDLNKDGHLDGSEVGHWVLPPAQDQPLVEANHLLHESDTDKDGRLSKAEILGNWNMFVGSQATNYGEDLTRHHDEL

Molecular Formula

57333 (Gene_ID) Q96D15 (K21-L328) (Accession)

Molecular Weight

Approximately 43.0 kDa

Shipping Conditions

Dry ice

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-INSI2 antibody
STJ190337 200 µl

Anti-INSI2 antibody

Sign In for Pricing
View Details
p3*Flag-CMV-10-ZEB1 Plasmid
PVTB00266-2b 2 µg

p3*Flag-CMV-10-ZEB1 Plasmid

Sign In for Pricing
View Details
DiagNano™ Protein G, QD 610 nm conjugate
PT-G004 100 µL

DiagNano™ Protein G, QD 610 nm conjugate

Sign In for Pricing
View Details
Polyclonal CIKS Antibody
APR15446G 0.1 mg

Polyclonal CIKS Antibody

Sign In for Pricing
View Details
Rat Cyclophilin B CYPB ELISA Kit
BG-RAT10609 1 Each

Rat Cyclophilin B CYPB ELISA Kit

Sign In for Pricing
View Details
Recombinant Anti-PGP9.5 antibody (Mouse mAb )
GB15159 100 μL

Recombinant Anti-PGP9.5 antibody (Mouse mAb )

Sign In for Pricing
View Details