RCN3, Human (HEK293, His)
The RCN3 protein is a possible molecular chaperone that contributes to endoplasmic reticulum protein biosynthesis and transport. RCN3 is critical for pulmonary surfactant homeostasis and is required for the correct biosynthesis and transport of SP-A, SP-D, and ABCA3. RCN3 Protein, Human (HEK293, His) is the recombinant human-derived RCN3 protein, expressed by HEK293 , with C-6*His labeled tag.
Product Specifications
Product Name Alternative
RCN3 Protein, Human (HEK293, His), Human, HEK293
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/rcn3-protein-human-hek-293-his.html
Purity
95.0
Smiles
KPSPDAGPHGQGRVHQAAPLSDAPHDDAHGNFQYDHEAFLGREVAKEFDQLTPEESQARLGRIVDRMDRAGDGDGWVSLAELRAWIAHTQQRHIRDSVSAAWDTYDTDRDGRVGWEELRNATYGHYAPGEEFHDVEDAETYKKMLARDERRFRVADQDGDSMATREELTAFLHPEEFPHMRDIVIAETLEDLDRNKDGYVQVEEYIADLYSAEPGEEEPAWVQTERQQFRDFRDLNKDGHLDGSEVGHWVLPPAQDQPLVEANHLLHESDTDKDGRLSKAEILGNWNMFVGSQATNYGEDLTRHHDEL
Molecular Formula
57333 (Gene_ID) Q96D15 (K21-L328) (Accession)
Molecular Weight
Approximately 43.0 kDa
Shipping Conditions
Dry ice
Storage Conditions
Stored at -80°C for 1 year
Scientific Category
Recombinant Proteins
Available Sizes
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS6021214-01 100 mg
5-Chloro-1,2-benzisothiazol-3(2H)-one (5-Chloro-1,2-benzisothiazol-3(2H)-one, 5-Chlorobenzisothiazolone)
Sign In for Pricing
View Details 
MBS6021214-02 5x 100 mg
5-Chloro-1,2-benzisothiazol-3(2H)-one (5-Chloro-1,2-benzisothiazol-3(2H)-one, 5-Chlorobenzisothiazolone)
Sign In for Pricing
View Details K1598502 1.0 µg DNA
PAX3 sgRNA CRISPR Lentivector (Human) (Target 1)
Sign In for Pricing
View Details 
SYP-M0397-01 48 Well
Mouse FABP1(Fatty Acid Binding Protein 1, Liver) ELISA Kit
Sign In for Pricing
View Details SYP-M0397-02 96 Well
Mouse FABP1(Fatty Acid Binding Protein 1, Liver) ELISA Kit
Sign In for Pricing
View Details 