Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RCN3, Human (HEK293, His)

The RCN3 protein is a possible molecular chaperone that contributes to endoplasmic reticulum protein biosynthesis and transport. RCN3 is critical for pulmonary surfactant homeostasis and is required for the correct biosynthesis and transport of SP-A, SP-D, and ABCA3. RCN3 Protein, Human (HEK293, His) is the recombinant human-derived RCN3 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

RCN3 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/rcn3-protein-human-hek-293-his.html

Purity

95.0

Smiles

KPSPDAGPHGQGRVHQAAPLSDAPHDDAHGNFQYDHEAFLGREVAKEFDQLTPEESQARLGRIVDRMDRAGDGDGWVSLAELRAWIAHTQQRHIRDSVSAAWDTYDTDRDGRVGWEELRNATYGHYAPGEEFHDVEDAETYKKMLARDERRFRVADQDGDSMATREELTAFLHPEEFPHMRDIVIAETLEDLDRNKDGYVQVEEYIADLYSAEPGEEEPAWVQTERQQFRDFRDLNKDGHLDGSEVGHWVLPPAQDQPLVEANHLLHESDTDKDGRLSKAEILGNWNMFVGSQATNYGEDLTRHHDEL

Molecular Formula

57333 (Gene_ID) Q96D15 (K21-L328) (Accession)

Molecular Weight

Approximately 43.0 kDa

Shipping Conditions

Dry ice

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit anti-GSTA1 Antibody
MBS4507740-01 0.05 mL

Rabbit anti-GSTA1 Antibody

Sign In for Pricing
View Details
Rabbit anti-GSTA1 Antibody
MBS4507740-02 0.1 mL

Rabbit anti-GSTA1 Antibody

Sign In for Pricing
View Details
Rabbit anti-GSTA1 Antibody
MBS4507740-03 5x 0.1 mL

Rabbit anti-GSTA1 Antibody

Sign In for Pricing
View Details
Porcine Macrophage Colony-Stimulating Factor Receptor (M-CSFR) ELISA Kit
NSL0368Po 96 Tests

Porcine Macrophage Colony-Stimulating Factor Receptor (M-CSFR) ELISA Kit

Sign In for Pricing
View Details
Mouse Soluble Cluster of differentiation 30 ligand, sCD30L GENLISA ELISA
KLM0057 96 Well

Mouse Soluble Cluster of differentiation 30 ligand, sCD30L GENLISA ELISA

Sign In for Pricing
View Details
Aselizumab
abx831152-01 100 µg

Aselizumab

Sign In for Pricing
View Details