Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RCN3, Human (HEK293, His)

The RCN3 protein is a possible molecular chaperone that contributes to endoplasmic reticulum protein biosynthesis and transport. RCN3 is critical for pulmonary surfactant homeostasis and is required for the correct biosynthesis and transport of SP-A, SP-D, and ABCA3. RCN3 Protein, Human (HEK293, His) is the recombinant human-derived RCN3 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

RCN3 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/rcn3-protein-human-hek-293-his.html

Purity

95.0

Smiles

KPSPDAGPHGQGRVHQAAPLSDAPHDDAHGNFQYDHEAFLGREVAKEFDQLTPEESQARLGRIVDRMDRAGDGDGWVSLAELRAWIAHTQQRHIRDSVSAAWDTYDTDRDGRVGWEELRNATYGHYAPGEEFHDVEDAETYKKMLARDERRFRVADQDGDSMATREELTAFLHPEEFPHMRDIVIAETLEDLDRNKDGYVQVEEYIADLYSAEPGEEEPAWVQTERQQFRDFRDLNKDGHLDGSEVGHWVLPPAQDQPLVEANHLLHESDTDKDGRLSKAEILGNWNMFVGSQATNYGEDLTRHHDEL

Molecular Formula

57333 (Gene_ID) Q96D15 (K21-L328) (Accession)

Molecular Weight

Approximately 43.0 kDa

Shipping Conditions

Dry ice

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit anti-Escherichia coli (strain K12) YBFF Polyclonal Antibody
MBS7149258 Inquire

Rabbit anti-Escherichia coli (strain K12) YBFF Polyclonal Antibody

Sign In for Pricing
View Details
Mouse Monoclonal ARH Antibody (OTI7E11) [Dylight 594]
NBP2-71790DL594 0.1 mL

Mouse Monoclonal ARH Antibody (OTI7E11) [Dylight 594]

Sign In for Pricing
View Details
TATA box-binding Protein-like Protein 1 (TBPL1) (FITC)
336593-01 50 µg

TATA box-binding Protein-like Protein 1 (TBPL1) (FITC)

Sign In for Pricing
View Details
TATA box-binding Protein-like Protein 1 (TBPL1) (FITC)
336593-02 100 µg

TATA box-binding Protein-like Protein 1 (TBPL1) (FITC)

Sign In for Pricing
View Details
Recombinant Pseudomonas Aeruginosa rpsT Protein (aa 1-91) (strain UCBPP-PA14)
VAng-Cr0915-1mgEcoli 1 mg (E. coli)

Recombinant Pseudomonas Aeruginosa rpsT Protein (aa 1-91) (strain UCBPP-PA14)

Sign In for Pricing
View Details
SASH3 sgRNA CRISPR Lentivector set (Human)
K2090301 3x 1.0 µg

SASH3 sgRNA CRISPR Lentivector set (Human)

Sign In for Pricing
View Details