Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RCN3, Human (HEK293, His)

The RCN3 protein is a possible molecular chaperone that contributes to endoplasmic reticulum protein biosynthesis and transport. RCN3 is critical for pulmonary surfactant homeostasis and is required for the correct biosynthesis and transport of SP-A, SP-D, and ABCA3. RCN3 Protein, Human (HEK293, His) is the recombinant human-derived RCN3 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

RCN3 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/rcn3-protein-human-hek-293-his.html

Purity

95.0

Smiles

KPSPDAGPHGQGRVHQAAPLSDAPHDDAHGNFQYDHEAFLGREVAKEFDQLTPEESQARLGRIVDRMDRAGDGDGWVSLAELRAWIAHTQQRHIRDSVSAAWDTYDTDRDGRVGWEELRNATYGHYAPGEEFHDVEDAETYKKMLARDERRFRVADQDGDSMATREELTAFLHPEEFPHMRDIVIAETLEDLDRNKDGYVQVEEYIADLYSAEPGEEEPAWVQTERQQFRDFRDLNKDGHLDGSEVGHWVLPPAQDQPLVEANHLLHESDTDKDGRLSKAEILGNWNMFVGSQATNYGEDLTRHHDEL

Molecular Formula

57333 (Gene_ID) Q96D15 (K21-L328) (Accession)

Molecular Weight

Approximately 43.0 kDa

Shipping Conditions

Dry ice

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

PRR20D 3'UTR Luciferase Stable Cell Line
TU018929 1.0 mL

PRR20D 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
MESP1, NT (MESP1, BHLHC5, Mesoderm posterior protein 1, Class C basic helix-loop-helix protein 5) (FITC) discontinued
038365-FITC 200 µL

MESP1, NT (MESP1, BHLHC5, Mesoderm posterior protein 1, Class C basic helix-loop-helix protein 5) (FITC) discontinued

Sign In for Pricing
View Details
FSDBeadTM Europium, Carboxylated 0.2um
EPS5001_10 ml 10 ml

FSDBeadTM Europium, Carboxylated 0.2um

Sign In for Pricing
View Details
Lentiviral mouse Foxred1 shRNA (UAS) - Lentiviral mouse Foxred1 shRNA (UAS) (25)
GTR15294464 1 Vial

Lentiviral mouse Foxred1 shRNA (UAS) - Lentiviral mouse Foxred1 shRNA (UAS) (25)

Sign In for Pricing
View Details
Dipeptidyl peptidase 8 (DPP8) Human ELISA Kit
C9082 96 Tests

Dipeptidyl peptidase 8 (DPP8) Human ELISA Kit

Sign In for Pricing
View Details
Human Heparanase (HPA) ELISA Kit
JL11914-01 48 Tests

Human Heparanase (HPA) ELISA Kit

Sign In for Pricing
View Details