Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RCN3, Human (HEK293, His)

The RCN3 protein is a possible molecular chaperone that contributes to endoplasmic reticulum protein biosynthesis and transport. RCN3 is critical for pulmonary surfactant homeostasis and is required for the correct biosynthesis and transport of SP-A, SP-D, and ABCA3. RCN3 Protein, Human (HEK293, His) is the recombinant human-derived RCN3 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

RCN3 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/rcn3-protein-human-hek-293-his.html

Purity

95.0

Smiles

KPSPDAGPHGQGRVHQAAPLSDAPHDDAHGNFQYDHEAFLGREVAKEFDQLTPEESQARLGRIVDRMDRAGDGDGWVSLAELRAWIAHTQQRHIRDSVSAAWDTYDTDRDGRVGWEELRNATYGHYAPGEEFHDVEDAETYKKMLARDERRFRVADQDGDSMATREELTAFLHPEEFPHMRDIVIAETLEDLDRNKDGYVQVEEYIADLYSAEPGEEEPAWVQTERQQFRDFRDLNKDGHLDGSEVGHWVLPPAQDQPLVEANHLLHESDTDKDGRLSKAEILGNWNMFVGSQATNYGEDLTRHHDEL

Molecular Formula

57333 (Gene_ID) Q96D15 (K21-L328) (Accession)

Molecular Weight

Approximately 43.0 kDa

Shipping Conditions

Dry ice

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Human CASP3 Nanobody (VHH1)
HW555023-01 50 µg

Anti-Human CASP3 Nanobody (VHH1)

Sign In for Pricing
View Details
Anti-Human CASP3 Nanobody (VHH1)
HW555023-02 100 µg

Anti-Human CASP3 Nanobody (VHH1)

Sign In for Pricing
View Details
Anti-Human CASP3 Nanobody (VHH1)
HW555023-03 1 mg

Anti-Human CASP3 Nanobody (VHH1)

Sign In for Pricing
View Details
MRGPRF (Mas-Related G-Protein Coupled Receptor Member F, MAS-Related GPR, Member F)
486073 100 µL

MRGPRF (Mas-Related G-Protein Coupled Receptor Member F, MAS-Related GPR, Member F)

Sign In for Pricing
View Details
Canine C1r ELISA Kit
ECC0359 96 Tests

Canine C1r ELISA Kit

Sign In for Pricing
View Details
FITC-Linked Polyclonal Antibody to Matrix Metalloproteinase 13 (MMP13)
MBS2037715-01 0.1 mL

FITC-Linked Polyclonal Antibody to Matrix Metalloproteinase 13 (MMP13)

Sign In for Pricing
View Details