Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RCN3, Human (HEK293, His)

The RCN3 protein is a possible molecular chaperone that contributes to endoplasmic reticulum protein biosynthesis and transport. RCN3 is critical for pulmonary surfactant homeostasis and is required for the correct biosynthesis and transport of SP-A, SP-D, and ABCA3. RCN3 Protein, Human (HEK293, His) is the recombinant human-derived RCN3 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

RCN3 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/rcn3-protein-human-hek-293-his.html

Purity

95.0

Smiles

KPSPDAGPHGQGRVHQAAPLSDAPHDDAHGNFQYDHEAFLGREVAKEFDQLTPEESQARLGRIVDRMDRAGDGDGWVSLAELRAWIAHTQQRHIRDSVSAAWDTYDTDRDGRVGWEELRNATYGHYAPGEEFHDVEDAETYKKMLARDERRFRVADQDGDSMATREELTAFLHPEEFPHMRDIVIAETLEDLDRNKDGYVQVEEYIADLYSAEPGEEEPAWVQTERQQFRDFRDLNKDGHLDGSEVGHWVLPPAQDQPLVEANHLLHESDTDKDGRLSKAEILGNWNMFVGSQATNYGEDLTRHHDEL

Molecular Formula

57333 (Gene_ID) Q96D15 (K21-L328) (Accession)

Molecular Weight

Approximately 43.0 kDa

Shipping Conditions

Dry ice

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

MEX3D Antibody
KC-28734-01 50 μL

MEX3D Antibody

Sign In for Pricing
View Details
MEX3D Antibody
KC-28734-02 100 µL

MEX3D Antibody

Sign In for Pricing
View Details
MEX3D Antibody
KC-28734-03 1 mL

MEX3D Antibody

Sign In for Pricing
View Details
Cytosine beta-D-arabinofuranoside (≥98.0%, Reagent grade)
ST1204-1g 1 g

Cytosine beta-D-arabinofuranoside (≥98.0%, Reagent grade)

Sign In for Pricing
View Details
FETUB Protein Vector (Human) (pPB-C-His)
PV016085 500 ng

FETUB Protein Vector (Human) (pPB-C-His)

Sign In for Pricing
View Details
Adarb1 (NM_001111056) Rat Tagged ORF Clone
RR200424 10 µg

Adarb1 (NM_001111056) Rat Tagged ORF Clone

Sign In for Pricing
View Details