Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RCN3, Human (HEK293, His)

The RCN3 protein is a possible molecular chaperone that contributes to endoplasmic reticulum protein biosynthesis and transport. RCN3 is critical for pulmonary surfactant homeostasis and is required for the correct biosynthesis and transport of SP-A, SP-D, and ABCA3. RCN3 Protein, Human (HEK293, His) is the recombinant human-derived RCN3 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

RCN3 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/rcn3-protein-human-hek-293-his.html

Purity

95.0

Smiles

KPSPDAGPHGQGRVHQAAPLSDAPHDDAHGNFQYDHEAFLGREVAKEFDQLTPEESQARLGRIVDRMDRAGDGDGWVSLAELRAWIAHTQQRHIRDSVSAAWDTYDTDRDGRVGWEELRNATYGHYAPGEEFHDVEDAETYKKMLARDERRFRVADQDGDSMATREELTAFLHPEEFPHMRDIVIAETLEDLDRNKDGYVQVEEYIADLYSAEPGEEEPAWVQTERQQFRDFRDLNKDGHLDGSEVGHWVLPPAQDQPLVEANHLLHESDTDKDGRLSKAEILGNWNMFVGSQATNYGEDLTRHHDEL

Molecular Formula

57333 (Gene_ID) Q96D15 (K21-L328) (Accession)

Molecular Weight

Approximately 43.0 kDa

Shipping Conditions

Dry ice

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

GCSF Receptor (CSF3R) Human shRNA Plasmid Kit (Locus ID 1441)
TL313700 1 Kit

GCSF Receptor (CSF3R) Human shRNA Plasmid Kit (Locus ID 1441)

Sign In for Pricing
View Details
MMP3, NT (MMP3, STMY1, Stromelysin-1, Matrix metalloproteinase-3, Transin-1)
MBS6005501-01 0.2 mL

MMP3, NT (MMP3, STMY1, Stromelysin-1, Matrix metalloproteinase-3, Transin-1)

Sign In for Pricing
View Details
MMP3, NT (MMP3, STMY1, Stromelysin-1, Matrix metalloproteinase-3, Transin-1)
MBS6005501-02 5x 0.2 mL

MMP3, NT (MMP3, STMY1, Stromelysin-1, Matrix metalloproteinase-3, Transin-1)

Sign In for Pricing
View Details
Macrophage (FITC)
138105-FITC 100 µL

Macrophage (FITC)

Sign In for Pricing
View Details
Lrrtm2 Mouse Gene Knockout Kit (CRISPR)
KN509517 1 Kit

Lrrtm2 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Lentiviral mouse Ormdl1 shRNA (UAS) - Lentiviral mouse Ormdl1 shRNA (UAS, RFP) (25)
GTR15134363 1 Vial

Lentiviral mouse Ormdl1 shRNA (UAS) - Lentiviral mouse Ormdl1 shRNA (UAS, RFP) (25)

Sign In for Pricing
View Details