Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RCN3, Human (HEK293, His)

The RCN3 protein is a possible molecular chaperone that contributes to endoplasmic reticulum protein biosynthesis and transport. RCN3 is critical for pulmonary surfactant homeostasis and is required for the correct biosynthesis and transport of SP-A, SP-D, and ABCA3. RCN3 Protein, Human (HEK293, His) is the recombinant human-derived RCN3 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

RCN3 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/rcn3-protein-human-hek-293-his.html

Purity

95.0

Smiles

KPSPDAGPHGQGRVHQAAPLSDAPHDDAHGNFQYDHEAFLGREVAKEFDQLTPEESQARLGRIVDRMDRAGDGDGWVSLAELRAWIAHTQQRHIRDSVSAAWDTYDTDRDGRVGWEELRNATYGHYAPGEEFHDVEDAETYKKMLARDERRFRVADQDGDSMATREELTAFLHPEEFPHMRDIVIAETLEDLDRNKDGYVQVEEYIADLYSAEPGEEEPAWVQTERQQFRDFRDLNKDGHLDGSEVGHWVLPPAQDQPLVEANHLLHESDTDKDGRLSKAEILGNWNMFVGSQATNYGEDLTRHHDEL

Molecular Formula

57333 (Gene_ID) Q96D15 (K21-L328) (Accession)

Molecular Weight

Approximately 43.0 kDa

Shipping Conditions

Dry ice

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-p70 S6 kinase alpha antibody
STJ94920 200 µl

Anti-p70 S6 kinase alpha antibody

Sign In for Pricing
View Details
mLxip Mouse shRNA Lentiviral Particle (Locus ID 208104)
TL509582V 500 µL Each

mLxip Mouse shRNA Lentiviral Particle (Locus ID 208104)

Sign In for Pricing
View Details
Phospho-NDEL1 (Thr219) Polyclonal Antibody, PerCP-Cy5.5 Conjugated
bs-5524R-PerCP-Cy5.5 100 µL

Phospho-NDEL1 (Thr219) Polyclonal Antibody, PerCP-Cy5.5 Conjugated

Sign In for Pricing
View Details
DUT Peptide - N-terminal region
MBS3232966-01 0.1 mg

DUT Peptide - N-terminal region

Sign In for Pricing
View Details
DUT Peptide - N-terminal region
MBS3232966-02 5x 0.1 mg

DUT Peptide - N-terminal region

Sign In for Pricing
View Details
COL4A2, NT (COL4A2, Collagen alpha-2(IV) chain, Canstatin) (MaxLight 550)
MBS6287687-01 0.1 mL

COL4A2, NT (COL4A2, Collagen alpha-2(IV) chain, Canstatin) (MaxLight 550)

Sign In for Pricing
View Details