Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RCN3, Human (HEK293, His)

The RCN3 protein is a possible molecular chaperone that contributes to endoplasmic reticulum protein biosynthesis and transport. RCN3 is critical for pulmonary surfactant homeostasis and is required for the correct biosynthesis and transport of SP-A, SP-D, and ABCA3. RCN3 Protein, Human (HEK293, His) is the recombinant human-derived RCN3 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

RCN3 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/rcn3-protein-human-hek-293-his.html

Purity

95.0

Smiles

KPSPDAGPHGQGRVHQAAPLSDAPHDDAHGNFQYDHEAFLGREVAKEFDQLTPEESQARLGRIVDRMDRAGDGDGWVSLAELRAWIAHTQQRHIRDSVSAAWDTYDTDRDGRVGWEELRNATYGHYAPGEEFHDVEDAETYKKMLARDERRFRVADQDGDSMATREELTAFLHPEEFPHMRDIVIAETLEDLDRNKDGYVQVEEYIADLYSAEPGEEEPAWVQTERQQFRDFRDLNKDGHLDGSEVGHWVLPPAQDQPLVEANHLLHESDTDKDGRLSKAEILGNWNMFVGSQATNYGEDLTRHHDEL

Molecular Formula

57333 (Gene_ID) Q96D15 (K21-L328) (Accession)

Molecular Weight

Approximately 43.0 kDa

Shipping Conditions

Dry ice

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZNF85 (Zinc Finger Protein 85, Zinc Finger Protein HPF4, HPF 4, HPF4, HTF 1, HTF1, MGC78566) (Azide Free) (MaxLight 750) discontinued
Z0737-85-ML750 100 µL

ZNF85 (Zinc Finger Protein 85, Zinc Finger Protein HPF4, HPF 4, HPF4, HTF 1, HTF1, MGC78566) (Azide Free) (MaxLight 750) discontinued

Sign In for Pricing
View Details
MRP-L49 shRNA (m) Lentiviral Particles
sc-149610-V 200 µL

MRP-L49 shRNA (m) Lentiviral Particles

Sign In for Pricing
View Details
hCG (CGA) Mouse Monoclonal Antibody [Clone ID: 77F12]
2H8-77F12 1 mg

hCG (CGA) Mouse Monoclonal Antibody [Clone ID: 77F12]

Sign In for Pricing
View Details
Mycoplasma pulmonis PCR kit
PCR-M414-96D 100T

Mycoplasma pulmonis PCR kit

Sign In for Pricing
View Details
RNAS4 Polyclonal Antibody
UB-GEN-7129 100 µL

RNAS4 Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant Human CD159a/KLRC1 Protein, N-Fc
E55P1468 50 µg

Recombinant Human CD159a/KLRC1 Protein, N-Fc

Sign In for Pricing
View Details