Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RCN3, Human (HEK293, His)

The RCN3 protein is a possible molecular chaperone that contributes to endoplasmic reticulum protein biosynthesis and transport. RCN3 is critical for pulmonary surfactant homeostasis and is required for the correct biosynthesis and transport of SP-A, SP-D, and ABCA3. RCN3 Protein, Human (HEK293, His) is the recombinant human-derived RCN3 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

RCN3 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/rcn3-protein-human-hek-293-his.html

Purity

95.0

Smiles

KPSPDAGPHGQGRVHQAAPLSDAPHDDAHGNFQYDHEAFLGREVAKEFDQLTPEESQARLGRIVDRMDRAGDGDGWVSLAELRAWIAHTQQRHIRDSVSAAWDTYDTDRDGRVGWEELRNATYGHYAPGEEFHDVEDAETYKKMLARDERRFRVADQDGDSMATREELTAFLHPEEFPHMRDIVIAETLEDLDRNKDGYVQVEEYIADLYSAEPGEEEPAWVQTERQQFRDFRDLNKDGHLDGSEVGHWVLPPAQDQPLVEANHLLHESDTDKDGRLSKAEILGNWNMFVGSQATNYGEDLTRHHDEL

Molecular Formula

57333 (Gene_ID) Q96D15 (K21-L328) (Accession)

Molecular Weight

Approximately 43.0 kDa

Shipping Conditions

Dry ice

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mif sgRNA CRISPR Lentivector (Rat) (Target 3)
K6979704 1.0 µg DNA

Mif sgRNA CRISPR Lentivector (Rat) (Target 3)

Sign In for Pricing
View Details
NF kappaB p105/p50 Antibody
AF6217-01 100 µL

NF kappaB p105/p50 Antibody

Sign In for Pricing
View Details
NF kappaB p105/p50 Antibody
AF6217-02 200 µL

NF kappaB p105/p50 Antibody

Sign In for Pricing
View Details
Genorise® Canine IL-10 polyclonal antibody
GR105145 100 µg

Genorise® Canine IL-10 polyclonal antibody

Sign In for Pricing
View Details
Interleukin 1 Receptor Associated Kinase 4 (IRAK4) Antibody
abx027074-01 80 µL

Interleukin 1 Receptor Associated Kinase 4 (IRAK4) Antibody

Sign In for Pricing
View Details
Interleukin 1 Receptor Associated Kinase 4 (IRAK4) Antibody
abx027074-02 400 µL

Interleukin 1 Receptor Associated Kinase 4 (IRAK4) Antibody

Sign In for Pricing
View Details