Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RCN3, Human (HEK293, His)

The RCN3 protein is a possible molecular chaperone that contributes to endoplasmic reticulum protein biosynthesis and transport. RCN3 is critical for pulmonary surfactant homeostasis and is required for the correct biosynthesis and transport of SP-A, SP-D, and ABCA3. RCN3 Protein, Human (HEK293, His) is the recombinant human-derived RCN3 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

RCN3 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/rcn3-protein-human-hek-293-his.html

Purity

95.0

Smiles

KPSPDAGPHGQGRVHQAAPLSDAPHDDAHGNFQYDHEAFLGREVAKEFDQLTPEESQARLGRIVDRMDRAGDGDGWVSLAELRAWIAHTQQRHIRDSVSAAWDTYDTDRDGRVGWEELRNATYGHYAPGEEFHDVEDAETYKKMLARDERRFRVADQDGDSMATREELTAFLHPEEFPHMRDIVIAETLEDLDRNKDGYVQVEEYIADLYSAEPGEEEPAWVQTERQQFRDFRDLNKDGHLDGSEVGHWVLPPAQDQPLVEANHLLHESDTDKDGRLSKAEILGNWNMFVGSQATNYGEDLTRHHDEL

Molecular Formula

57333 (Gene_ID) Q96D15 (K21-L328) (Accession)

Molecular Weight

Approximately 43.0 kDa

Shipping Conditions

Dry ice

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Histone Deacetylase 10, NT (HDAC10, HD10)
318878-01 50 µg

Histone Deacetylase 10, NT (HDAC10, HD10)

Sign In for Pricing
View Details
Histone Deacetylase 10, NT (HDAC10, HD10)
318878-02 100 µg

Histone Deacetylase 10, NT (HDAC10, HD10)

Sign In for Pricing
View Details
CENPA   monoclonal antibody
MB10288 50ul

CENPA monoclonal antibody

Sign In for Pricing
View Details
Lrsam1 Mouse qPCR Template Standard (NM_199302)
MK205039 1 Kit

Lrsam1 Mouse qPCR Template Standard (NM_199302)

Sign In for Pricing
View Details
pLV3-U6-OTUB1-3UTR-shRNA1-Puro Plasmid
PVT54492 2 µg

pLV3-U6-OTUB1-3UTR-shRNA1-Puro Plasmid

Sign In for Pricing
View Details
Cobl Rat shRNA Plasmid (Locus ID 305497)
TL705806 1 Kit

Cobl Rat shRNA Plasmid (Locus ID 305497)

Sign In for Pricing
View Details