Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RCN3, Human (HEK293, His)

The RCN3 protein is a possible molecular chaperone that contributes to endoplasmic reticulum protein biosynthesis and transport. RCN3 is critical for pulmonary surfactant homeostasis and is required for the correct biosynthesis and transport of SP-A, SP-D, and ABCA3. RCN3 Protein, Human (HEK293, His) is the recombinant human-derived RCN3 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

RCN3 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/rcn3-protein-human-hek-293-his.html

Purity

95.0

Smiles

KPSPDAGPHGQGRVHQAAPLSDAPHDDAHGNFQYDHEAFLGREVAKEFDQLTPEESQARLGRIVDRMDRAGDGDGWVSLAELRAWIAHTQQRHIRDSVSAAWDTYDTDRDGRVGWEELRNATYGHYAPGEEFHDVEDAETYKKMLARDERRFRVADQDGDSMATREELTAFLHPEEFPHMRDIVIAETLEDLDRNKDGYVQVEEYIADLYSAEPGEEEPAWVQTERQQFRDFRDLNKDGHLDGSEVGHWVLPPAQDQPLVEANHLLHESDTDKDGRLSKAEILGNWNMFVGSQATNYGEDLTRHHDEL

Molecular Formula

57333 (Gene_ID) Q96D15 (K21-L328) (Accession)

Molecular Weight

Approximately 43.0 kDa

Shipping Conditions

Dry ice

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

BCMA (TNFRSF17) Rabbit Polyclonal Antibody
TA311846 100 µL

BCMA (TNFRSF17) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
KRTAP25-1, CT (KRTAP25-1, KAP25.1, Keratin-associated protein 25-1) (Biotin) discontinued
037642-Biotin 200 µL

KRTAP25-1, CT (KRTAP25-1, KAP25.1, Keratin-associated protein 25-1) (Biotin) discontinued

Sign In for Pricing
View Details
Ikzf2 Mouse Gene Knockout Kit (CRISPR)
KN508214 1 Kit

Ikzf2 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Human IL-20 Antibody Pair Set
ABPR-ZB045 5 plates, 15 plates

Human IL-20 Antibody Pair Set

Sign In for Pricing
View Details
Lentiviral mouse Ube2n shRNA (UAS) - Lentiviral mouse Ube2n shRNA (UAS) (25)
GTR15266069 1 Vial

Lentiviral mouse Ube2n shRNA (UAS) - Lentiviral mouse Ube2n shRNA (UAS) (25)

Sign In for Pricing
View Details
Plod2 (NM_011961) Mouse Tagged Lenti ORF Clone
MR210368L4 10 µg

Plod2 (NM_011961) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details