Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RCN3, Human (HEK293, His)

The RCN3 protein is a possible molecular chaperone that contributes to endoplasmic reticulum protein biosynthesis and transport. RCN3 is critical for pulmonary surfactant homeostasis and is required for the correct biosynthesis and transport of SP-A, SP-D, and ABCA3. RCN3 Protein, Human (HEK293, His) is the recombinant human-derived RCN3 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

RCN3 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/rcn3-protein-human-hek-293-his.html

Purity

95.0

Smiles

KPSPDAGPHGQGRVHQAAPLSDAPHDDAHGNFQYDHEAFLGREVAKEFDQLTPEESQARLGRIVDRMDRAGDGDGWVSLAELRAWIAHTQQRHIRDSVSAAWDTYDTDRDGRVGWEELRNATYGHYAPGEEFHDVEDAETYKKMLARDERRFRVADQDGDSMATREELTAFLHPEEFPHMRDIVIAETLEDLDRNKDGYVQVEEYIADLYSAEPGEEEPAWVQTERQQFRDFRDLNKDGHLDGSEVGHWVLPPAQDQPLVEANHLLHESDTDKDGRLSKAEILGNWNMFVGSQATNYGEDLTRHHDEL

Molecular Formula

57333 (Gene_ID) Q96D15 (K21-L328) (Accession)

Molecular Weight

Approximately 43.0 kDa

Shipping Conditions

Dry ice

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

EPCAM Mouse Monoclonal Antibody [Clone ID: Ber-EP4]
DM406-05 500 µL

EPCAM Mouse Monoclonal Antibody [Clone ID: Ber-EP4]

Sign In for Pricing
View Details
SAP 145 (C-12)
sc-514930 200 µg/mL

SAP 145 (C-12)

Sign In for Pricing
View Details
RSF1 Rabbit Polyclonal Antibody
E28PN1206 100 µL

RSF1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
SEC23A Protein Vector (Mouse) (pPM-C-HA)
PV227404 500 ng

SEC23A Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
Recombinant Mycobacterium Bovis dapA Protein (aa 1-300)
VAng-Yyj3264-1mgEcoli 1 mg (E. coli)

Recombinant Mycobacterium Bovis dapA Protein (aa 1-300)

Sign In for Pricing
View Details
POLR3D (DNA-directed RNA Polymerase III Subunit RPC4, RNA Polymerase III Subunit C4, DNA-directed RNA Polymerase III Subunit D, Protein BN51, RNA Polymerase III 47 kDa Subunit, RPC53 Homolog, BN51, BN51T)
MBS647646-01 0.05 mg

POLR3D (DNA-directed RNA Polymerase III Subunit RPC4, RNA Polymerase III Subunit C4, DNA-directed RNA Polymerase III Subunit D, Protein BN51, RNA Polymerase III 47 kDa Subunit, RPC53 Homolog, BN51, BN51T)

Sign In for Pricing
View Details