Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RCN3, Human (HEK293, His)

The RCN3 protein is a possible molecular chaperone that contributes to endoplasmic reticulum protein biosynthesis and transport. RCN3 is critical for pulmonary surfactant homeostasis and is required for the correct biosynthesis and transport of SP-A, SP-D, and ABCA3. RCN3 Protein, Human (HEK293, His) is the recombinant human-derived RCN3 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

RCN3 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/rcn3-protein-human-hek-293-his.html

Purity

95.0

Smiles

KPSPDAGPHGQGRVHQAAPLSDAPHDDAHGNFQYDHEAFLGREVAKEFDQLTPEESQARLGRIVDRMDRAGDGDGWVSLAELRAWIAHTQQRHIRDSVSAAWDTYDTDRDGRVGWEELRNATYGHYAPGEEFHDVEDAETYKKMLARDERRFRVADQDGDSMATREELTAFLHPEEFPHMRDIVIAETLEDLDRNKDGYVQVEEYIADLYSAEPGEEEPAWVQTERQQFRDFRDLNKDGHLDGSEVGHWVLPPAQDQPLVEANHLLHESDTDKDGRLSKAEILGNWNMFVGSQATNYGEDLTRHHDEL

Molecular Formula

57333 (Gene_ID) Q96D15 (K21-L328) (Accession)

Molecular Weight

Approximately 43.0 kDa

Shipping Conditions

Dry ice

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

β-defensin 18 CRISPR Activation Plasmid (m2)
sc-437050-ACT-2 20 µg

β-defensin 18 CRISPR Activation Plasmid (m2)

Sign In for Pricing
View Details
Mouse Complement C5 ELISA Kit
CEK1440 96 Tests

Mouse Complement C5 ELISA Kit

Sign In for Pricing
View Details
Rabbit Monoclonal MAD2L1-binding protein Antibody
NBP3-33204-100ul 100 µL

Rabbit Monoclonal MAD2L1-binding protein Antibody

Sign In for Pricing
View Details
Dimeric Pregnancy-Associated Plasma Protein (dPAPP-A) Antibody
abx024296 1 mg

Dimeric Pregnancy-Associated Plasma Protein (dPAPP-A) Antibody

Sign In for Pricing
View Details
RPL23P6 3'UTR GFP Stable Cell Line
TU071151 1.0 mL

RPL23P6 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Asf1a sgRNA CRISPR Lentivector (Mouse) (Target 2)
K4986403 1.0 µg DNA

Asf1a sgRNA CRISPR Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details