Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RCN3, Human (HEK293, His)

The RCN3 protein is a possible molecular chaperone that contributes to endoplasmic reticulum protein biosynthesis and transport. RCN3 is critical for pulmonary surfactant homeostasis and is required for the correct biosynthesis and transport of SP-A, SP-D, and ABCA3. RCN3 Protein, Human (HEK293, His) is the recombinant human-derived RCN3 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

RCN3 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/rcn3-protein-human-hek-293-his.html

Purity

95.0

Smiles

KPSPDAGPHGQGRVHQAAPLSDAPHDDAHGNFQYDHEAFLGREVAKEFDQLTPEESQARLGRIVDRMDRAGDGDGWVSLAELRAWIAHTQQRHIRDSVSAAWDTYDTDRDGRVGWEELRNATYGHYAPGEEFHDVEDAETYKKMLARDERRFRVADQDGDSMATREELTAFLHPEEFPHMRDIVIAETLEDLDRNKDGYVQVEEYIADLYSAEPGEEEPAWVQTERQQFRDFRDLNKDGHLDGSEVGHWVLPPAQDQPLVEANHLLHESDTDKDGRLSKAEILGNWNMFVGSQATNYGEDLTRHHDEL

Molecular Formula

57333 (Gene_ID) Q96D15 (K21-L328) (Accession)

Molecular Weight

Approximately 43.0 kDa

Shipping Conditions

Dry ice

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cox7a2 Mouse shRNA Plasmid (Locus ID 12866)
TL519038 1 Kit

Cox7a2 Mouse shRNA Plasmid (Locus ID 12866)

Sign In for Pricing
View Details
Olfr66 Mouse shRNA Plasmid (Locus ID 18367)
TL501552 1 Kit

Olfr66 Mouse shRNA Plasmid (Locus ID 18367)

Sign In for Pricing
View Details
NDUF3 (NDUFAF3) (NM_199073) Human Tagged ORF Clone Lentiviral Particle
RC217754L3V 200 µL

NDUF3 (NDUFAF3) (NM_199073) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
MBIP Polyclonal Antibody
E55A05047 100 µg

MBIP Polyclonal Antibody

Sign In for Pricing
View Details
4-Methylumbelliferyl-β-D-mannopyranoside
M-670-250-250mg 250 mg

4-Methylumbelliferyl-β-D-mannopyranoside

Sign In for Pricing
View Details
Ambp 3'UTR GFP Stable Cell Line
TU250564 1.0 mL

Ambp 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details