Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RCN3, Human (HEK293, His)

The RCN3 protein is a possible molecular chaperone that contributes to endoplasmic reticulum protein biosynthesis and transport. RCN3 is critical for pulmonary surfactant homeostasis and is required for the correct biosynthesis and transport of SP-A, SP-D, and ABCA3. RCN3 Protein, Human (HEK293, His) is the recombinant human-derived RCN3 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

RCN3 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/rcn3-protein-human-hek-293-his.html

Purity

95.0

Smiles

KPSPDAGPHGQGRVHQAAPLSDAPHDDAHGNFQYDHEAFLGREVAKEFDQLTPEESQARLGRIVDRMDRAGDGDGWVSLAELRAWIAHTQQRHIRDSVSAAWDTYDTDRDGRVGWEELRNATYGHYAPGEEFHDVEDAETYKKMLARDERRFRVADQDGDSMATREELTAFLHPEEFPHMRDIVIAETLEDLDRNKDGYVQVEEYIADLYSAEPGEEEPAWVQTERQQFRDFRDLNKDGHLDGSEVGHWVLPPAQDQPLVEANHLLHESDTDKDGRLSKAEILGNWNMFVGSQATNYGEDLTRHHDEL

Molecular Formula

57333 (Gene_ID) Q96D15 (K21-L328) (Accession)

Molecular Weight

Approximately 43.0 kDa

Shipping Conditions

Dry ice

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human SERPINA11 shRNA (UAS) - Lentiviral human SERPINA11 shRNA (UAS) (100)
GTR15158298 1 Vial

Lentiviral human SERPINA11 shRNA (UAS) - Lentiviral human SERPINA11 shRNA (UAS) (100)

Sign In for Pricing
View Details
MEA1 Knockout HEK293T Polyclonal Cells
ARG4282 1 Million

MEA1 Knockout HEK293T Polyclonal Cells

Sign In for Pricing
View Details
Prostaglandin E Synthase 3 (p23) Antibody (Streptavidin)
abx444535 100 µg

Prostaglandin E Synthase 3 (p23) Antibody (Streptavidin)

Sign In for Pricing
View Details
Hpgd (NM_024390) Rat Tagged ORF Clone Lentiviral Particle
RR212381L4V 200 µL

Hpgd (NM_024390) Rat Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Human MARCKS Related Protein ELISA Kit (MARCKSL1)
RK01818 96 Tests

Human MARCKS Related Protein ELISA Kit (MARCKSL1)

Sign In for Pricing
View Details
ADM Antibody
MBS7127805-01 0.05 mL

ADM Antibody

Sign In for Pricing
View Details