Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RCN3, Human (HEK293, His)

The RCN3 protein is a possible molecular chaperone that contributes to endoplasmic reticulum protein biosynthesis and transport. RCN3 is critical for pulmonary surfactant homeostasis and is required for the correct biosynthesis and transport of SP-A, SP-D, and ABCA3. RCN3 Protein, Human (HEK293, His) is the recombinant human-derived RCN3 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

RCN3 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/rcn3-protein-human-hek-293-his.html

Purity

95.0

Smiles

KPSPDAGPHGQGRVHQAAPLSDAPHDDAHGNFQYDHEAFLGREVAKEFDQLTPEESQARLGRIVDRMDRAGDGDGWVSLAELRAWIAHTQQRHIRDSVSAAWDTYDTDRDGRVGWEELRNATYGHYAPGEEFHDVEDAETYKKMLARDERRFRVADQDGDSMATREELTAFLHPEEFPHMRDIVIAETLEDLDRNKDGYVQVEEYIADLYSAEPGEEEPAWVQTERQQFRDFRDLNKDGHLDGSEVGHWVLPPAQDQPLVEANHLLHESDTDKDGRLSKAEILGNWNMFVGSQATNYGEDLTRHHDEL

Molecular Formula

57333 (Gene_ID) Q96D15 (K21-L328) (Accession)

Molecular Weight

Approximately 43.0 kDa

Shipping Conditions

Dry ice

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

SARS-CoV-2 (COVID-19) NSP16 Recombinant Protein N-His Tag Lyophilized
MBS8430835 Inquire

SARS-CoV-2 (COVID-19) NSP16 Recombinant Protein N-His Tag Lyophilized

Sign In for Pricing
View Details
SLC25A32 (NM_030780) Human Tagged Lenti ORF Clone
RC204580L1 10 µg

SLC25A32 (NM_030780) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Prl7d1 AAV siRNA Pooled Vector
37698164 1.0 µg

Prl7d1 AAV siRNA Pooled Vector

Sign In for Pricing
View Details
Recombinant Human D-Dopachrome Tautomerase
7-02644 5 µg

Recombinant Human D-Dopachrome Tautomerase

Sign In for Pricing
View Details
C10orf135 Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a)
LV758266 1.0 µg DNA

C10orf135 Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a)

Sign In for Pricing
View Details
Helix pomatia (HPA, Edible Snail) (Texas Red)
H1842-09 2 mL

Helix pomatia (HPA, Edible Snail) (Texas Red)

Sign In for Pricing
View Details