Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RCN3, Human (HEK293, His)

The RCN3 protein is a possible molecular chaperone that contributes to endoplasmic reticulum protein biosynthesis and transport. RCN3 is critical for pulmonary surfactant homeostasis and is required for the correct biosynthesis and transport of SP-A, SP-D, and ABCA3. RCN3 Protein, Human (HEK293, His) is the recombinant human-derived RCN3 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

RCN3 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/rcn3-protein-human-hek-293-his.html

Purity

95.0

Smiles

KPSPDAGPHGQGRVHQAAPLSDAPHDDAHGNFQYDHEAFLGREVAKEFDQLTPEESQARLGRIVDRMDRAGDGDGWVSLAELRAWIAHTQQRHIRDSVSAAWDTYDTDRDGRVGWEELRNATYGHYAPGEEFHDVEDAETYKKMLARDERRFRVADQDGDSMATREELTAFLHPEEFPHMRDIVIAETLEDLDRNKDGYVQVEEYIADLYSAEPGEEEPAWVQTERQQFRDFRDLNKDGHLDGSEVGHWVLPPAQDQPLVEANHLLHESDTDKDGRLSKAEILGNWNMFVGSQATNYGEDLTRHHDEL

Molecular Formula

57333 (Gene_ID) Q96D15 (K21-L328) (Accession)

Molecular Weight

Approximately 43.0 kDa

Shipping Conditions

Dry ice

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal Lgr6 Antibody (918719R) [PE/Cy5.5]
FAB8458RPECY55 0.1 mL

Mouse Monoclonal Lgr6 Antibody (918719R) [PE/Cy5.5]

Sign In for Pricing
View Details
TDO2 discontinued
531892-01 20 µL

TDO2 discontinued

Sign In for Pricing
View Details
TDO2 discontinued
531892-02 100 µL

TDO2 discontinued

Sign In for Pricing
View Details
IRAK M, Blocking Peptide (IL-1 Receptor-associated Kinase)
I8600-20P 50 µg

IRAK M, Blocking Peptide (IL-1 Receptor-associated Kinase)

Sign In for Pricing
View Details
Mouse Monoclonal Salmonella typhimurium Antibody (1E6) [DyLight 755]
NB110-16952IR 0.2 mL

Mouse Monoclonal Salmonella typhimurium Antibody (1E6) [DyLight 755]

Sign In for Pricing
View Details
NDUFAF4, NT (NDUFAF4, C6orf66, HRPAP20, NADH dehydrogenase [ubiquinone] 1 alpha subcomplex assembly factor 4, Hormone-regulated proliferation-associated protein of 20kD) (AP) discontinued
038863-AP 200 µL

NDUFAF4, NT (NDUFAF4, C6orf66, HRPAP20, NADH dehydrogenase [ubiquinone] 1 alpha subcomplex assembly factor 4, Hormone-regulated proliferation-associated protein of 20kD) (AP) discontinued

Sign In for Pricing
View Details