Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RCN3, Human (HEK293, His)

The RCN3 protein is a possible molecular chaperone that contributes to endoplasmic reticulum protein biosynthesis and transport. RCN3 is critical for pulmonary surfactant homeostasis and is required for the correct biosynthesis and transport of SP-A, SP-D, and ABCA3. RCN3 Protein, Human (HEK293, His) is the recombinant human-derived RCN3 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

RCN3 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/rcn3-protein-human-hek-293-his.html

Purity

95.0

Smiles

KPSPDAGPHGQGRVHQAAPLSDAPHDDAHGNFQYDHEAFLGREVAKEFDQLTPEESQARLGRIVDRMDRAGDGDGWVSLAELRAWIAHTQQRHIRDSVSAAWDTYDTDRDGRVGWEELRNATYGHYAPGEEFHDVEDAETYKKMLARDERRFRVADQDGDSMATREELTAFLHPEEFPHMRDIVIAETLEDLDRNKDGYVQVEEYIADLYSAEPGEEEPAWVQTERQQFRDFRDLNKDGHLDGSEVGHWVLPPAQDQPLVEANHLLHESDTDKDGRLSKAEILGNWNMFVGSQATNYGEDLTRHHDEL

Molecular Formula

57333 (Gene_ID) Q96D15 (K21-L328) (Accession)

Molecular Weight

Approximately 43.0 kDa

Shipping Conditions

Dry ice

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

AATF (NM_012138) Human Tagged Lenti ORF Clone
RC200070L3 10 µg

AATF (NM_012138) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Anti-GAstV Capsid Protein VP34 Polyclonal Antibody
VK150044-01 50 µg

Anti-GAstV Capsid Protein VP34 Polyclonal Antibody

Sign In for Pricing
View Details
Anti-GAstV Capsid Protein VP34 Polyclonal Antibody
VK150044-02 100 µg

Anti-GAstV Capsid Protein VP34 Polyclonal Antibody

Sign In for Pricing
View Details
Neurofibrillary Tangle rabbit polyclonal antibody
RA19077-100 100 µL

Neurofibrillary Tangle rabbit polyclonal antibody

Sign In for Pricing
View Details
SATL1 Lentiviral Vector (Mouse) (CMV) (pLenti-GIII-CMV)
43041064 1.0 µg DNA

SATL1 Lentiviral Vector (Mouse) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
Prkar2b (NM_011158) Mouse Tagged Lenti ORF Clone
MR206576L4 10 µg

Prkar2b (NM_011158) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details