Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RCN3, Human (HEK293, His)

The RCN3 protein is a possible molecular chaperone that contributes to endoplasmic reticulum protein biosynthesis and transport. RCN3 is critical for pulmonary surfactant homeostasis and is required for the correct biosynthesis and transport of SP-A, SP-D, and ABCA3. RCN3 Protein, Human (HEK293, His) is the recombinant human-derived RCN3 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

RCN3 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/rcn3-protein-human-hek-293-his.html

Purity

95.0

Smiles

KPSPDAGPHGQGRVHQAAPLSDAPHDDAHGNFQYDHEAFLGREVAKEFDQLTPEESQARLGRIVDRMDRAGDGDGWVSLAELRAWIAHTQQRHIRDSVSAAWDTYDTDRDGRVGWEELRNATYGHYAPGEEFHDVEDAETYKKMLARDERRFRVADQDGDSMATREELTAFLHPEEFPHMRDIVIAETLEDLDRNKDGYVQVEEYIADLYSAEPGEEEPAWVQTERQQFRDFRDLNKDGHLDGSEVGHWVLPPAQDQPLVEANHLLHESDTDKDGRLSKAEILGNWNMFVGSQATNYGEDLTRHHDEL

Molecular Formula

57333 (Gene_ID) Q96D15 (K21-L328) (Accession)

Molecular Weight

Approximately 43.0 kDa

Shipping Conditions

Dry ice

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Burkholderia cenocepacia Monofunctional biosynthetic peptidoglycan transglycosylase (mtgA)
MBS7021853-01 0.02 mg

Recombinant Burkholderia cenocepacia Monofunctional biosynthetic peptidoglycan transglycosylase (mtgA)

Sign In for Pricing
View Details
Recombinant Burkholderia cenocepacia Monofunctional biosynthetic peptidoglycan transglycosylase (mtgA)
MBS7021853-02 0.1 mg

Recombinant Burkholderia cenocepacia Monofunctional biosynthetic peptidoglycan transglycosylase (mtgA)

Sign In for Pricing
View Details
Recombinant Burkholderia cenocepacia Monofunctional biosynthetic peptidoglycan transglycosylase (mtgA)
MBS7021853-03 5x 0.1 mg

Recombinant Burkholderia cenocepacia Monofunctional biosynthetic peptidoglycan transglycosylase (mtgA)

Sign In for Pricing
View Details
CYB5A Human Pre-designed siRNA Set A
HY-RS03417 1 Set

CYB5A Human Pre-designed siRNA Set A

Sign In for Pricing
View Details
Lentiviral mouse Ints1 shRNA (UAS) - Lentiviral mouse Ints1 shRNA (UAS, GFP) plasmid
GTR15198994 1 Vial

Lentiviral mouse Ints1 shRNA (UAS) - Lentiviral mouse Ints1 shRNA (UAS, GFP) plasmid

Sign In for Pricing
View Details
Lunatic Fringe Homolog (LFNG, 3-beta-N-acetylglucosaminyltransferase, Beta-1,3-N-acetylglucosaminyltransferase Lunatic Fringe, O-Fucosylpeptide, SCDO3, EC 2.4.1.222) (MaxLight 550)
129250-ML550 100 µL

Lunatic Fringe Homolog (LFNG, 3-beta-N-acetylglucosaminyltransferase, Beta-1,3-N-acetylglucosaminyltransferase Lunatic Fringe, O-Fucosylpeptide, SCDO3, EC 2.4.1.222) (MaxLight 550)

Sign In for Pricing
View Details