Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RCN3, Human (HEK293, His)

The RCN3 protein is a possible molecular chaperone that contributes to endoplasmic reticulum protein biosynthesis and transport. RCN3 is critical for pulmonary surfactant homeostasis and is required for the correct biosynthesis and transport of SP-A, SP-D, and ABCA3. RCN3 Protein, Human (HEK293, His) is the recombinant human-derived RCN3 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

RCN3 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/rcn3-protein-human-hek-293-his.html

Purity

95.0

Smiles

KPSPDAGPHGQGRVHQAAPLSDAPHDDAHGNFQYDHEAFLGREVAKEFDQLTPEESQARLGRIVDRMDRAGDGDGWVSLAELRAWIAHTQQRHIRDSVSAAWDTYDTDRDGRVGWEELRNATYGHYAPGEEFHDVEDAETYKKMLARDERRFRVADQDGDSMATREELTAFLHPEEFPHMRDIVIAETLEDLDRNKDGYVQVEEYIADLYSAEPGEEEPAWVQTERQQFRDFRDLNKDGHLDGSEVGHWVLPPAQDQPLVEANHLLHESDTDKDGRLSKAEILGNWNMFVGSQATNYGEDLTRHHDEL

Molecular Formula

57333 (Gene_ID) Q96D15 (K21-L328) (Accession)

Molecular Weight

Approximately 43.0 kDa

Shipping Conditions

Dry ice

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Bovine Zinc finger protein 526, ZNF526 ELISA KIT
ELI-17665b 96 Tests

Bovine Zinc finger protein 526, ZNF526 ELISA KIT

Sign In for Pricing
View Details
HRH1 Polyclonal Antibody, PE-Cy5 Conjugated
bs-6663R-PE-Cy5 100 µL

HRH1 Polyclonal Antibody, PE-Cy5 Conjugated

Sign In for Pricing
View Details
Muramyl Dipeptide
456693-01 1 mg

Muramyl Dipeptide

Sign In for Pricing
View Details
Muramyl Dipeptide
456693-02 2.5 mg

Muramyl Dipeptide

Sign In for Pricing
View Details
CELF4 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)
LV640114 1.0 µg DNA

CELF4 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)

Sign In for Pricing
View Details
Constitutive androstane receptor (NR1I3) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI9E1]
TA805366AM 100 µL

Constitutive androstane receptor (NR1I3) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI9E1]

Sign In for Pricing
View Details