Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FGFR-3, Human (His-B2M)

The FGFR-3 protein is a tyrosine-protein kinase receptor for fibroblast growth factor that is critical for cellular processes, particularly in chondrocytes, osteoblasts, and inner ear development. Its effects span normal skeletal development and postnatal bone mineralization. FGFR-3 Protein, Human (His-B2M) is the recombinant human-derived FGFR-3 protein, expressed by E. coli , with N-6*His, N-B2M labeled tag.

Product Specifications

Product Name Alternative

FGFR-3 Protein, Human (His-B2M), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/fgfr-3-protein-human-his-b2m.html

Purity

94.00

Smiles

RLRSPPKKGLGSPTVHKISRFPLKRQVSLESNASMSSNTPLVRIARLSSGEGPTLANVSELELPADPKWELSRARLTLGKPLGEGCFGQVVMAEAIGIDKDRAAKPVTVAVKMLKDDATDKDLSDLVSEMEMMKMIGKHKNIINLLGACTQGGPLYVLVEYAAKGNLREFLRARRPPGLDYSFDTCKPPEEQLTFKDLVSCAYQVARGMEYLASQKCIHRDLAARNVLVTEDNVMKIADFGLARDVHNLDYYKKTTNGRLPVKWMAPEALFDRVYTHQSDVWSFGVLLWEIFTLGGSPYPGIPVEELFKLLKEGHRMDKPANCTHDLYMIMRECWHAAPSQRPTFKQLVEDLDRVLTVTSTDEYLDLSAPFEQYSPGGQDTPSSSSSGDDSVFAHDLLPPAPPSSGGSRT

Molecular Formula

2261 (Gene_ID) P22607-1 (R397-T806) (Accession)

Molecular Weight

Approximately 59.4 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NLK Rabbit Monoclonal Antibody
TA423698 100 µL

NLK Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
HER-2 / CD340 (HRB2/718), CF594 conjugate, 0.1mg/mL
BNC940718-500 1x 500 µL

HER-2 / CD340 (HRB2/718), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CCDC83 (NM_173556) Human Recombinant Protein
TP323659M 100 µg

CCDC83 (NM_173556) Human Recombinant Protein

Sign In for Pricing
View Details
Eph receptor B4 (EPHB4) (NM_004444) Human Recombinant Protein
TP308559 20 µg

Eph receptor B4 (EPHB4) (NM_004444) Human Recombinant Protein

Sign In for Pricing
View Details
Deoxydihydroartemisinin (Alpha,Beta Mixture)
TRC-D239660-10MG 10 mg

Deoxydihydroartemisinin (Alpha,Beta Mixture)

Sign In for Pricing
View Details
PAX8 (Renal Cell Marker) (PAX8/1492), CF488A conjugate, 0.1mg/mL
BNC881492-500 1x 500 µL

PAX8 (Renal Cell Marker) (PAX8/1492), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details