Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FGFR-3, Human (His-B2M)

The FGFR-3 protein is a tyrosine-protein kinase receptor for fibroblast growth factor that is critical for cellular processes, particularly in chondrocytes, osteoblasts, and inner ear development. Its effects span normal skeletal development and postnatal bone mineralization. FGFR-3 Protein, Human (His-B2M) is the recombinant human-derived FGFR-3 protein, expressed by E. coli , with N-6*His, N-B2M labeled tag.

Product Specifications

Product Name Alternative

FGFR-3 Protein, Human (His-B2M), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/fgfr-3-protein-human-his-b2m.html

Purity

94.00

Smiles

RLRSPPKKGLGSPTVHKISRFPLKRQVSLESNASMSSNTPLVRIARLSSGEGPTLANVSELELPADPKWELSRARLTLGKPLGEGCFGQVVMAEAIGIDKDRAAKPVTVAVKMLKDDATDKDLSDLVSEMEMMKMIGKHKNIINLLGACTQGGPLYVLVEYAAKGNLREFLRARRPPGLDYSFDTCKPPEEQLTFKDLVSCAYQVARGMEYLASQKCIHRDLAARNVLVTEDNVMKIADFGLARDVHNLDYYKKTTNGRLPVKWMAPEALFDRVYTHQSDVWSFGVLLWEIFTLGGSPYPGIPVEELFKLLKEGHRMDKPANCTHDLYMIMRECWHAAPSQRPTFKQLVEDLDRVLTVTSTDEYLDLSAPFEQYSPGGQDTPSSSSSGDDSVFAHDLLPPAPPSSGGSRT

Molecular Formula

2261 (Gene_ID) P22607-1 (R397-T806) (Accession)

Molecular Weight

Approximately 59.4 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TIPRL Human Gene Knockout Kit (CRISPR)
KN201185BN 1 Kit

TIPRL Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Frozen Tissue Sections, Kidney
CS629485 5x 5 µm

Frozen Tissue Sections, Kidney

Sign In for Pricing
View Details
EPHX2 (NM_001979) Human Over-expression Lysate
LC419612 20 µg

EPHX2 (NM_001979) Human Over-expression Lysate

Sign In for Pricing
View Details
TyraMaxTM Amplification Dye Spectral Sampler
#33031 1 Kit

TyraMaxTM Amplification Dye Spectral Sampler

Sign In for Pricing
View Details
NKAPD1 Human qPCR Primer Pair (NM_018195)
HP225457 200 Reactions

NKAPD1 Human qPCR Primer Pair (NM_018195)

Sign In for Pricing
View Details
Vmn1r130 Mouse Gene Knockout Kit (CRISPR)
KN518933 1 Kit

Vmn1r130 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details