Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FGFR-3, Human (His-B2M)

The FGFR-3 protein is a tyrosine-protein kinase receptor for fibroblast growth factor that is critical for cellular processes, particularly in chondrocytes, osteoblasts, and inner ear development. Its effects span normal skeletal development and postnatal bone mineralization. FGFR-3 Protein, Human (His-B2M) is the recombinant human-derived FGFR-3 protein, expressed by E. coli , with N-6*His, N-B2M labeled tag.

Product Specifications

Product Name Alternative

FGFR-3 Protein, Human (His-B2M), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/fgfr-3-protein-human-his-b2m.html

Purity

94.00

Smiles

RLRSPPKKGLGSPTVHKISRFPLKRQVSLESNASMSSNTPLVRIARLSSGEGPTLANVSELELPADPKWELSRARLTLGKPLGEGCFGQVVMAEAIGIDKDRAAKPVTVAVKMLKDDATDKDLSDLVSEMEMMKMIGKHKNIINLLGACTQGGPLYVLVEYAAKGNLREFLRARRPPGLDYSFDTCKPPEEQLTFKDLVSCAYQVARGMEYLASQKCIHRDLAARNVLVTEDNVMKIADFGLARDVHNLDYYKKTTNGRLPVKWMAPEALFDRVYTHQSDVWSFGVLLWEIFTLGGSPYPGIPVEELFKLLKEGHRMDKPANCTHDLYMIMRECWHAAPSQRPTFKQLVEDLDRVLTVTSTDEYLDLSAPFEQYSPGGQDTPSSSSSGDDSVFAHDLLPPAPPSSGGSRT

Molecular Formula

2261 (Gene_ID) P22607-1 (R397-T806) (Accession)

Molecular Weight

Approximately 59.4 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ATG14L (ATG14) Human Gene Knockout Kit (CRISPR)
KN420325 1 Kit

ATG14L (ATG14) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Von Willebrand Factor / Factor VIII Related-Ag (Endothelial Marker) (rVWF/1465), CF488A conjugate, 0.1mg/mL
BNC881540-500 1x 500 µL

Von Willebrand Factor / Factor VIII Related-Ag (Endothelial Marker) (rVWF/1465), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MIR1244-2 Human qPCR Primer Pair (MI0015974)
HP300687 200 Reactions

MIR1244-2 Human qPCR Primer Pair (MI0015974)

Sign In for Pricing
View Details
ENPP6 (NM_153343) Human Recombinant Protein
TP306360M 100 µg

ENPP6 (NM_153343) Human Recombinant Protein

Sign In for Pricing
View Details
9,10-Dibromoanthracene-2-sulfonyl Chloride
TRC-D423500-50MG 50 mg

9,10-Dibromoanthracene-2-sulfonyl Chloride

Sign In for Pricing
View Details
FABP3 Mouse Monoclonal Antibody [Clone ID: OTI5E4]
CF813947 100 µg

FABP3 Mouse Monoclonal Antibody [Clone ID: OTI5E4]

Sign In for Pricing
View Details