Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FGFR-3, Human (His-B2M)

The FGFR-3 protein is a tyrosine-protein kinase receptor for fibroblast growth factor that is critical for cellular processes, particularly in chondrocytes, osteoblasts, and inner ear development. Its effects span normal skeletal development and postnatal bone mineralization. FGFR-3 Protein, Human (His-B2M) is the recombinant human-derived FGFR-3 protein, expressed by E. coli , with N-6*His, N-B2M labeled tag.

Product Specifications

Product Name Alternative

FGFR-3 Protein, Human (His-B2M), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/fgfr-3-protein-human-his-b2m.html

Purity

94.00

Smiles

RLRSPPKKGLGSPTVHKISRFPLKRQVSLESNASMSSNTPLVRIARLSSGEGPTLANVSELELPADPKWELSRARLTLGKPLGEGCFGQVVMAEAIGIDKDRAAKPVTVAVKMLKDDATDKDLSDLVSEMEMMKMIGKHKNIINLLGACTQGGPLYVLVEYAAKGNLREFLRARRPPGLDYSFDTCKPPEEQLTFKDLVSCAYQVARGMEYLASQKCIHRDLAARNVLVTEDNVMKIADFGLARDVHNLDYYKKTTNGRLPVKWMAPEALFDRVYTHQSDVWSFGVLLWEIFTLGGSPYPGIPVEELFKLLKEGHRMDKPANCTHDLYMIMRECWHAAPSQRPTFKQLVEDLDRVLTVTSTDEYLDLSAPFEQYSPGGQDTPSSSSSGDDSVFAHDLLPPAPPSSGGSRT

Molecular Formula

2261 (Gene_ID) P22607-1 (R397-T806) (Accession)

Molecular Weight

Approximately 59.4 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

EPO Antibody
orb1252226 100 µg

EPO Antibody

Sign In for Pricing
View Details
RBBP6 Rabbit Polyclonal Antibody (Biotin)
orb2985139 100 µg

RBBP6 Rabbit Polyclonal Antibody (Biotin)

Sign In for Pricing
View Details
Goat anti-AKAP12 Antibody
dAP-0021 50 µg

Goat anti-AKAP12 Antibody

Sign In for Pricing
View Details
RPL23A Rabbit Polyclonal Antibody (PerCP)
orb2471973 100 µL

RPL23A Rabbit Polyclonal Antibody (PerCP)

Sign In for Pricing
View Details
Recombinant Novosphingobium aromaticivorans tRNA pseudouridine synthase B (truB)
MBS1427987-01 0.02 mg (E-Coli)

Recombinant Novosphingobium aromaticivorans tRNA pseudouridine synthase B (truB)

Sign In for Pricing
View Details
Recombinant Novosphingobium aromaticivorans tRNA pseudouridine synthase B (truB)
MBS1427987-02 0.02 mg (Yeast)

Recombinant Novosphingobium aromaticivorans tRNA pseudouridine synthase B (truB)

Sign In for Pricing
View Details