Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OCIAD2 Antibody

Product Specifications

No additional specifications available.

More Discoveries

Explore Other Products

Browse additional items from our catalog

H-HSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNRNNIA-OH

PH00241-01 1 mg

H-HSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNRNNIA-OH

Sign In for Pricing

H-HSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNRNNIA-OH

PH00241-02 10 mg

H-HSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNRNNIA-OH

Sign In for Pricing

H-HSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNRNNIA-OH

PH00241-03 100 mg

H-HSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNRNNIA-OH

Sign In for Pricing

NCALD Protein Vector (Human) (pPM-C-HA)

31532021 500 ng

NCALD Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing

Recombinant Shigella Boydii rpsQ Protein (aa 1-84) (strain CDC 3083-94 / BS512)

VAng-Lsx09369-50gEcoli 50 µg (E. coli)

Recombinant Shigella Boydii rpsQ Protein (aa 1-84) (strain CDC 3083-94 / BS512)

Sign In for Pricing

Mouse Foxp1 (BC064764) AAV Particle

MR209941A1V 250 µL

Mouse Foxp1 (BC064764) AAV Particle

Sign In for Pricing