Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IGF-I/IGF-1, Rat

IGF-I/IGF-1 Protein, Rat has somatomedin activity and ability to potently promote neuronal survival.

Product Specifications

Product Name Alternative

IGF-I/IGF-1 Protein, Rat, Rat, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/igf-i-igf-1-protein-rat.html

Purity

96.00

Smiles

GPETLCGAELVDALQFVCGPRGFYFNKPTGYGSSIRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPTKSA

Molecular Formula

24482 (Gene_ID) P08025 (G49-A118) (Accession)

Molecular Weight

Approximately 9 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Schoenle E, et al. Insulin-like growth factor I stimulates growth in hypophysectomized rats. Nature. 1982 Mar 18;296 (5854) :252-3.|[2]Thorne RG, et al. Delivery of insulin-like growth factor-I to the rat brain and spinal cord along olfactory and trigeminal pathways following intranasal administration. Neuroscience. 2004;127 (2) :481-96.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

PNMA3 (NM_013364) Human Tagged Lenti ORF Clone
RC218987L4 10 µg

PNMA3 (NM_013364) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
1110034B05Rik 3'UTR GFP Stable Cell Line
TU150055 1.0 mL

1110034B05Rik 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Rabbit anti-Clostridium scindens (strain JCM 10418/VPI 12708) BAIE Polyclonal Antibody
MBS7153369 Inquire

Rabbit anti-Clostridium scindens (strain JCM 10418/VPI 12708) BAIE Polyclonal Antibody

Sign In for Pricing
View Details
CD47 (BSA & Azide Free)
MBS6507175-01 0.1 mL

CD47 (BSA & Azide Free)

Sign In for Pricing
View Details
CD47 (BSA & Azide Free)
MBS6507175-02 5x 0.1 mL

CD47 (BSA & Azide Free)

Sign In for Pricing
View Details
Kcnj5 sgRNA CRISPR Lentivector (Rat) (Target 3)
K6926604 1.0 µg DNA

Kcnj5 sgRNA CRISPR Lentivector (Rat) (Target 3)

Sign In for Pricing
View Details