Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IGF-I/IGF-1, Rat

IGF-I/IGF-1 Protein, Rat has somatomedin activity and ability to potently promote neuronal survival.

Product Specifications

Product Name Alternative

IGF-I/IGF-1 Protein, Rat, Rat, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/igf-i-igf-1-protein-rat.html

Purity

96.00

Smiles

GPETLCGAELVDALQFVCGPRGFYFNKPTGYGSSIRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPTKSA

Molecular Formula

24482 (Gene_ID) P08025 (G49-A118) (Accession)

Molecular Weight

Approximately 9 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Schoenle E, et al. Insulin-like growth factor I stimulates growth in hypophysectomized rats. Nature. 1982 Mar 18;296 (5854) :252-3.|[2]Thorne RG, et al. Delivery of insulin-like growth factor-I to the rat brain and spinal cord along olfactory and trigeminal pathways following intranasal administration. Neuroscience. 2004;127 (2) :481-96.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Chmp2a Mouse shRNA Plasmid (Locus ID 68953)
TL504241 1 Kit

Chmp2a Mouse shRNA Plasmid (Locus ID 68953)

Ask
View Details
Usp1 Mouse Pre-designed siRNA Set A
HY-RS16567 1 Set

Usp1 Mouse Pre-designed siRNA Set A

Ask
View Details
CLOCK, ID (Circadian Locomoter Output Cycles Protein Kaput, hCLOCK, Class E Basic Helix-loop-helix Protein 8, BHLHE8, KIAA0334) (MaxLight 650) discontinued
C5843-02B-ML650 100 µL

CLOCK, ID (Circadian Locomoter Output Cycles Protein Kaput, hCLOCK, Class E Basic Helix-loop-helix Protein 8, BHLHE8, KIAA0334) (MaxLight 650) discontinued

Ask
View Details
Noxa1 (NM_172204) Mouse Tagged Lenti ORF Clone
MR207092L4 10 µg

Noxa1 (NM_172204) Mouse Tagged Lenti ORF Clone

Ask
View Details