Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IGF-I/IGF-1, Rat

IGF-I/IGF-1 Protein, Rat has somatomedin activity and ability to potently promote neuronal survival.

Product Specifications

Product Name Alternative

IGF-I/IGF-1 Protein, Rat, Rat, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/igf-i-igf-1-protein-rat.html

Purity

96.00

Smiles

GPETLCGAELVDALQFVCGPRGFYFNKPTGYGSSIRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPTKSA

Molecular Formula

24482 (Gene_ID) P08025 (G49-A118) (Accession)

Molecular Weight

Approximately 9 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Schoenle E, et al. Insulin-like growth factor I stimulates growth in hypophysectomized rats. Nature. 1982 Mar 18;296 (5854) :252-3.|[2]Thorne RG, et al. Delivery of insulin-like growth factor-I to the rat brain and spinal cord along olfactory and trigeminal pathways following intranasal administration. Neuroscience. 2004;127 (2) :481-96.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

PAX7 (Paired Box Protein Pax-7, HuP1, HUP1) discontinued
P3113-84F 50 µg

PAX7 (Paired Box Protein Pax-7, HuP1, HUP1) discontinued

Sign In for Pricing
View Details
Recombinant Human MORF4 Protein - (Dry Ice)
H00010934-P01-2ug 2 µg

Recombinant Human MORF4 Protein - (Dry Ice)

Sign In for Pricing
View Details
OMG (Oligodendrocyte-myelin Glycoprotein, OMGP) (PE)
MBS6159222-01 0.1 mL

OMG (Oligodendrocyte-myelin Glycoprotein, OMGP) (PE)

Sign In for Pricing
View Details
OMG (Oligodendrocyte-myelin Glycoprotein, OMGP) (PE)
MBS6159222-02 5x 0.1 mL

OMG (Oligodendrocyte-myelin Glycoprotein, OMGP) (PE)

Sign In for Pricing
View Details
FTO Polyclonal Antibody, AbBy Fluor™ 647 Conjugated
bs-7056R-BF647 100 µL

FTO Polyclonal Antibody, AbBy Fluor™ 647 Conjugated

Sign In for Pricing
View Details
Tmsb15b1 AAV siRNA Pooled Vector
47161164 1.0 µg

Tmsb15b1 AAV siRNA Pooled Vector

Sign In for Pricing
View Details