Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IGF-I/IGF-1, Rat

IGF-I/IGF-1 Protein, Rat has somatomedin activity and ability to potently promote neuronal survival.

Product Specifications

Product Name Alternative

IGF-I/IGF-1 Protein, Rat, Rat, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/igf-i-igf-1-protein-rat.html

Purity

96.00

Smiles

GPETLCGAELVDALQFVCGPRGFYFNKPTGYGSSIRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPTKSA

Molecular Formula

24482 (Gene_ID) P08025 (G49-A118) (Accession)

Molecular Weight

Approximately 9 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Schoenle E, et al. Insulin-like growth factor I stimulates growth in hypophysectomized rats. Nature. 1982 Mar 18;296 (5854) :252-3.|[2]Thorne RG, et al. Delivery of insulin-like growth factor-I to the rat brain and spinal cord along olfactory and trigeminal pathways following intranasal administration. Neuroscience. 2004;127 (2) :481-96.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

PE-Linked Polyclonal Antibody to Kallikrein 12 (KLK12)
MBS2071173-01 0.1 mL

PE-Linked Polyclonal Antibody to Kallikrein 12 (KLK12)

Sign In for Pricing
View Details
PE-Linked Polyclonal Antibody to Kallikrein 12 (KLK12)
MBS2071173-02 0.2 mL

PE-Linked Polyclonal Antibody to Kallikrein 12 (KLK12)

Sign In for Pricing
View Details
PE-Linked Polyclonal Antibody to Kallikrein 12 (KLK12)
MBS2071173-03 0.5 mL

PE-Linked Polyclonal Antibody to Kallikrein 12 (KLK12)

Sign In for Pricing
View Details
PE-Linked Polyclonal Antibody to Kallikrein 12 (KLK12)
MBS2071173-04 1 mL

PE-Linked Polyclonal Antibody to Kallikrein 12 (KLK12)

Sign In for Pricing
View Details
PE-Linked Polyclonal Antibody to Kallikrein 12 (KLK12)
MBS2071173-05 5 mL

PE-Linked Polyclonal Antibody to Kallikrein 12 (KLK12)

Sign In for Pricing
View Details
PE-Linked Polyclonal Antibody to Kallikrein 12 (KLK12)
MBS2071173-06 5x 5 mL

PE-Linked Polyclonal Antibody to Kallikrein 12 (KLK12)

Sign In for Pricing
View Details