Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IGF-I/IGF-1, Rat

IGF-I/IGF-1 Protein, Rat has somatomedin activity and ability to potently promote neuronal survival.

Product Specifications

Product Name Alternative

IGF-I/IGF-1 Protein, Rat, Rat, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/igf-i-igf-1-protein-rat.html

Purity

96.00

Smiles

GPETLCGAELVDALQFVCGPRGFYFNKPTGYGSSIRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPTKSA

Molecular Formula

24482 (Gene_ID) P08025 (G49-A118) (Accession)

Molecular Weight

Approximately 9 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Schoenle E, et al. Insulin-like growth factor I stimulates growth in hypophysectomized rats. Nature. 1982 Mar 18;296 (5854) :252-3.|[2]Thorne RG, et al. Delivery of insulin-like growth factor-I to the rat brain and spinal cord along olfactory and trigeminal pathways following intranasal administration. Neuroscience. 2004;127 (2) :481-96.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Rabbit Polyclonal DOK3 Antibody [HRP]
NBP2-99574H 0.1 mL

Rabbit Polyclonal DOK3 Antibody [HRP]

Ask
View Details
H11 rabbit pAb
UB-GEN-11777 100 µL

H11 rabbit pAb

Ask
View Details
PTX3, ID (PTX3, TNFAIP5, TSG14, Pentraxin-related protein PTX3, Pentaxin-related protein PTX3, Tumor necrosis factor alpha-induced protein 5, Tumor necrosis factor-inducible gene 14 protein) (Biotin) discontinued
040681-Biotin 200 µL

PTX3, ID (PTX3, TNFAIP5, TSG14, Pentraxin-related protein PTX3, Pentaxin-related protein PTX3, Tumor necrosis factor alpha-induced protein 5, Tumor necrosis factor-inducible gene 14 protein) (Biotin) discontinued

Ask
View Details
Nori® Human VEGF ELISA Kit- Synovial Fluid-2 Plates
GR111005-SF-2 2x 96 Well

Nori® Human VEGF ELISA Kit- Synovial Fluid-2 Plates

Ask
View Details
Recombinant Human RELT Protein
CRP2206-01 10 µg

Recombinant Human RELT Protein

Ask
View Details
Recombinant Human RELT Protein
CRP2206-02 50 µg

Recombinant Human RELT Protein

Ask
View Details