Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IGF-I/IGF-1, Rat

IGF-I/IGF-1 Protein, Rat has somatomedin activity and ability to potently promote neuronal survival.

Product Specifications

Product Name Alternative

IGF-I/IGF-1 Protein, Rat, Rat, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/igf-i-igf-1-protein-rat.html

Purity

96.00

Smiles

GPETLCGAELVDALQFVCGPRGFYFNKPTGYGSSIRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPTKSA

Molecular Formula

24482 (Gene_ID) P08025 (G49-A118) (Accession)

Molecular Weight

Approximately 9 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Schoenle E, et al. Insulin-like growth factor I stimulates growth in hypophysectomized rats. Nature. 1982 Mar 18;296 (5854) :252-3.|[2]Thorne RG, et al. Delivery of insulin-like growth factor-I to the rat brain and spinal cord along olfactory and trigeminal pathways following intranasal administration. Neuroscience. 2004;127 (2) :481-96.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Int-6 (A-11)
sc-133251 200 µg/mL

Int-6 (A-11)

Ask
View Details
Lentiviral human DNAJA1 sgRNA gene knockout kit - Lentiviral human DNAJA1 sgRNA gene knockout kit (plasmid)
GTR15364541 1 Vial

Lentiviral human DNAJA1 sgRNA gene knockout kit - Lentiviral human DNAJA1 sgRNA gene knockout kit (plasmid)

Ask
View Details
CD18 (Beta 2 Antigen CD18 (p95), Cell Surface Adhesion Glycoproteins LFA 1/CR3/p150 95 beta Subunit, Complement Receptor C3 beta Subunit, Integrin beta 2, ITGB2, LAD, LCAMB, Leukocyte Cell Adhesion Molecule CD18, LFA1, Lymphocyte Function Associated Antigen 1, Macrophage Antigen 1 (mac1) beta Subunit, MF17) (AP) discontinued
C2269-02F-AP 100 µL

CD18 (Beta 2 Antigen CD18 (p95), Cell Surface Adhesion Glycoproteins LFA 1/CR3/p150 95 beta Subunit, Complement Receptor C3 beta Subunit, Integrin beta 2, ITGB2, LAD, LCAMB, Leukocyte Cell Adhesion Molecule CD18, LFA1, Lymphocyte Function Associated Antigen 1, Macrophage Antigen 1 (mac1) beta Subunit, MF17) (AP) discontinued

Ask
View Details
Tween-20
IBS-BT102 100 mL

Tween-20

Ask
View Details
SNORD50A AAV Vector (Human) (CMV)
44890101 1 µg

SNORD50A AAV Vector (Human) (CMV)

Ask
View Details