Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IGF-I/IGF-1, Rat

IGF-I/IGF-1 Protein, Rat has somatomedin activity and ability to potently promote neuronal survival.

Product Specifications

Product Name Alternative

IGF-I/IGF-1 Protein, Rat, Rat, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/igf-i-igf-1-protein-rat.html

Purity

96.00

Smiles

GPETLCGAELVDALQFVCGPRGFYFNKPTGYGSSIRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPTKSA

Molecular Formula

24482 (Gene_ID) P08025 (G49-A118) (Accession)

Molecular Weight

Approximately 9 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Schoenle E, et al. Insulin-like growth factor I stimulates growth in hypophysectomized rats. Nature. 1982 Mar 18;296 (5854) :252-3.|[2]Thorne RG, et al. Delivery of insulin-like growth factor-I to the rat brain and spinal cord along olfactory and trigeminal pathways following intranasal administration. Neuroscience. 2004;127 (2) :481-96.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Sephs1 Rat siRNA Oligo Duplex (Locus ID 291314)
SR505939 1 Kit

Sephs1 Rat siRNA Oligo Duplex (Locus ID 291314)

Ask
View Details
CADM2 (Cell Adhesion Molecule 2, IGSF4D, Necl-3, Nectin-like 3, SynCAM2, Nectin-like Protein 3, SynCAM 2, NECL3) discontinued
170226 50 µg

CADM2 (Cell Adhesion Molecule 2, IGSF4D, Necl-3, Nectin-like 3, SynCAM2, Nectin-like Protein 3, SynCAM 2, NECL3) discontinued

Ask
View Details
Pla2g12a (NM_023196) Mouse Untagged Clone
MC202891 10 µg

Pla2g12a (NM_023196) Mouse Untagged Clone

Ask
View Details
Rabbit Polyclonal PR48 Antibody [Alexa Fluor 350]
NB100-41411AF350 0.1 mL

Rabbit Polyclonal PR48 Antibody [Alexa Fluor 350]

Ask
View Details
Human GRP Pre-designed siRNA Set B
SI006662B 1 Each

Human GRP Pre-designed siRNA Set B

Ask
View Details