Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IGF-I/IGF-1, Rat

IGF-I/IGF-1 Protein, Rat has somatomedin activity and ability to potently promote neuronal survival.

Product Specifications

Product Name Alternative

IGF-I/IGF-1 Protein, Rat, Rat, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/igf-i-igf-1-protein-rat.html

Purity

96.00

Smiles

GPETLCGAELVDALQFVCGPRGFYFNKPTGYGSSIRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPTKSA

Molecular Formula

24482 (Gene_ID) P08025 (G49-A118) (Accession)

Molecular Weight

Approximately 9 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Schoenle E, et al. Insulin-like growth factor I stimulates growth in hypophysectomized rats. Nature. 1982 Mar 18;296 (5854) :252-3.|[2]Thorne RG, et al. Delivery of insulin-like growth factor-I to the rat brain and spinal cord along olfactory and trigeminal pathways following intranasal administration. Neuroscience. 2004;127 (2) :481-96.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

ATOH7 (Protein Atonal Homolog 7, Class A Basic Helix-loop-helix Protein 13, bHLHa13, Helix-loop-helix Protein hATH-5, hATH5, ATH5, BHLHA13) (APC)
123690-APC 100 µL

ATOH7 (Protein Atonal Homolog 7, Class A Basic Helix-loop-helix Protein 13, bHLHa13, Helix-loop-helix Protein hATH-5, hATH5, ATH5, BHLHA13) (APC)

Ask
View Details
Human LARS2 shRNA Plasmid
abx958236-01 150 µg

Human LARS2 shRNA Plasmid

Ask
View Details
Human LARS2 shRNA Plasmid
abx958236-02 300 µg

Human LARS2 shRNA Plasmid

Ask
View Details
25-OH VD3 (32F9C4), mAb, Mouse
V00101-1 1 mg

25-OH VD3 (32F9C4), mAb, Mouse

Ask
View Details
Phospho-ETS1 (S251) Antibody
A21351-100UG 100 µg

Phospho-ETS1 (S251) Antibody

Ask
View Details
Rabbit Anti BCAM Polyclonal Affinity Purified (PBS with 0.05% sodium azide and 50% glycerol, pH7.4)(Western Blot, IHC, ELISA)
MBS8422737-01 0.12 mL

Rabbit Anti BCAM Polyclonal Affinity Purified (PBS with 0.05% sodium azide and 50% glycerol, pH7.4)(Western Blot, IHC, ELISA)

Ask
View Details