Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IGF-I/IGF-1, Rat

IGF-I/IGF-1 Protein, Rat has somatomedin activity and ability to potently promote neuronal survival.

Product Specifications

Product Name Alternative

IGF-I/IGF-1 Protein, Rat, Rat, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/igf-i-igf-1-protein-rat.html

Purity

96.00

Smiles

GPETLCGAELVDALQFVCGPRGFYFNKPTGYGSSIRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPTKSA

Molecular Formula

24482 (Gene_ID) P08025 (G49-A118) (Accession)

Molecular Weight

Approximately 9 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Schoenle E, et al. Insulin-like growth factor I stimulates growth in hypophysectomized rats. Nature. 1982 Mar 18;296 (5854) :252-3.|[2]Thorne RG, et al. Delivery of insulin-like growth factor-I to the rat brain and spinal cord along olfactory and trigeminal pathways following intranasal administration. Neuroscience. 2004;127 (2) :481-96.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

GENLISA Rabbit Anti Keyhole Limpet Hemocyanin IgG (Anti-KLH IgG) ELISA
KLX1027 1x 96 Well

GENLISA Rabbit Anti Keyhole Limpet Hemocyanin IgG (Anti-KLH IgG) ELISA

Ask
View Details
LTC4S Overexpression Lysate (Native) - (Dry Ice)
NBL1-12741 0.1 mg

LTC4S Overexpression Lysate (Native) - (Dry Ice)

Ask
View Details
Elongator Complex Protein 1 (ELP1, Inhibitor Of Kappa Light Polypeptide Gene Enhancer In B Cells Kinase Complex-associated Protein, IkappaB Kinase Complex-associated Protein, IKK Complex-associated Protein, IKBKAP, IKAP, DKFZP781H1425, DYS, FD, FLJ12497, IKI3, p150, TOT1) (MaxLight 650) discontinued
E2249-79P-ML650 100 µL

Elongator Complex Protein 1 (ELP1, Inhibitor Of Kappa Light Polypeptide Gene Enhancer In B Cells Kinase Complex-associated Protein, IkappaB Kinase Complex-associated Protein, IKK Complex-associated Protein, IKBKAP, IKAP, DKFZP781H1425, DYS, FD, FLJ12497, IKI3, p150, TOT1) (MaxLight 650) discontinued

Ask
View Details
SURF4 (NM_001280793) Human Tagged ORF Clone
RC236090 10 µg

SURF4 (NM_001280793) Human Tagged ORF Clone

Ask
View Details
CHD3(C-term) mouse mAb
UB-GEN-1045 100 µL

CHD3(C-term) mouse mAb

Ask
View Details
Recombinant Thermomicrobium roseum Formamidopyrimidine-DNA glycosylase (mutM)
MBS1037136-01 0.02 mg (E-Coli)

Recombinant Thermomicrobium roseum Formamidopyrimidine-DNA glycosylase (mutM)

Ask
View Details