Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CRADD, Human

As an adapter protein, CRADD forms a PIDDosome complex with PIDD1 and CASP2, activates CASP2 and initiates apoptosis. It also recruits CASP2 to the TNFR-1 signaling complex in the tumor necrosis factor-mediated pathway, interacting with RIPK1 and TRADD. CRADD Protein, Human is the recombinant human-derived CRADD protein, expressed by E. coli , with tag free.

Product Specifications

Product Name Alternative

CRADD Protein, Human, Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/death-domain-containing-protein-cradd-protein-human.html

Smiles

MEARDKQVLRSLRLELGAEVLVEGLVLQYLYQEGILTENHIQEINAQTTGLRKTMLLLDILPSRGPKAFDTFLDSLQEFPWVREKLKKAREEAMTDLPAGDRLTGIPSHILNSSPSDRQINQLAQRLGPEWEPMVLSLGLSQTDIYRCKANHPHNVQSQVVEAFIRWRQRFGKQATFQSLHNGLRAVEVDPSLLLHMLE

Molecular Formula

8738 (Gene_ID) P78560 (M1-E199) (Accession)

Molecular Weight

Approximately 21 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Insulin Like Growth Factor Binding Protein 6 (IGFBP6) Rat ELISA Kit
E2867 96 Tests

Insulin Like Growth Factor Binding Protein 6 (IGFBP6) Rat ELISA Kit

Ask
View Details
Microtubule-Associated Protein Tau Phospho-Thr231 (MAPT pT231) Antibody
abx000448-01 20 µL

Microtubule-Associated Protein Tau Phospho-Thr231 (MAPT pT231) Antibody

Ask
View Details
Microtubule-Associated Protein Tau Phospho-Thr231 (MAPT pT231) Antibody
abx000448-02 100 µL

Microtubule-Associated Protein Tau Phospho-Thr231 (MAPT pT231) Antibody

Ask
View Details
Microtubule-Associated Protein Tau Phospho-Thr231 (MAPT pT231) Antibody
abx000448-03 2x 100 µL

Microtubule-Associated Protein Tau Phospho-Thr231 (MAPT pT231) Antibody

Ask
View Details
Human PRAMEF20 siRNA
abx929630-01 15 nmol

Human PRAMEF20 siRNA

Ask
View Details
Human PRAMEF20 siRNA
abx929630-02 30 nmol

Human PRAMEF20 siRNA

Ask
View Details