CRADD, Human
As an adapter protein, CRADD forms a PIDDosome complex with PIDD1 and CASP2, activates CASP2 and initiates apoptosis. It also recruits CASP2 to the TNFR-1 signaling complex in the tumor necrosis factor-mediated pathway, interacting with RIPK1 and TRADD. CRADD Protein, Human is the recombinant human-derived CRADD protein, expressed by E. coli , with tag free.
Product Specifications
Product Name Alternative
CRADD Protein, Human, Human, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/death-domain-containing-protein-cradd-protein-human.html
Smiles
MEARDKQVLRSLRLELGAEVLVEGLVLQYLYQEGILTENHIQEINAQTTGLRKTMLLLDILPSRGPKAFDTFLDSLQEFPWVREKLKKAREEAMTDLPAGDRLTGIPSHILNSSPSDRQINQLAQRLGPEWEPMVLSLGLSQTDIYRCKANHPHNVQSQVVEAFIRWRQRFGKQATFQSLHNGLRAVEVDPSLLLHMLE
Molecular Formula
8738 (Gene_ID) P78560 (M1-E199) (Accession)
Molecular Weight
Approximately 21 kDa, based on SDS-PAGE under reducing conditions.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Scientific Category
Recombinant Proteins
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
