CTLA-4, Human (HEK293)
The CTLA-4 protein is a key inhibitory receptor and a major negative regulator of T cell responses in coordination of immune regulation. Its unique property is its significantly increased affinity for B7 ligands (CD80/CD86) compared with CD28. CTLA-4 Protein, Human (HEK293) is the recombinant human-derived CTLA-4 protein, expressed by HEK293 , with tag free.
Product Specifications
Product Name Alternative
CTLA-4 Protein, Human (HEK293), Human, HEK293
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/ctla-4-protein-human-hek293.html
Purity
95.0
Smiles
MACLGFQRHKAQLNLATRTWPCTLLFFLLFIPVFCKAMHVAQPAVVLASSRGIASFVCEYASPGKATEVRVTVLRQADSQVTEVCAATYMMGNELTFLDDSICTGTSSGNQVNLTIQGLRAMDTGLYICKVELMYPPPYYLGIGNGTQIYVIDPEPCPDSD
Molecular Formula
1493 (Gene_ID) P16410 (K36-D161) (Accession)
Molecular Weight
Approximately 13.5 kDa
Shipping Conditions
Dry ice
Storage Conditions
Stored at -80°C for 1 year
Scientific Category
Recombinant Proteins
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC470040-100 1x 100 µL
CD35 / CR1 (E11), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC680096-100 1x 100 µL
Histone H1 (AE-4), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC880580-100 1x 100 µL
Histone H1 (1415-1), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details 