Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CTLA-4, Human (HEK293)

The CTLA-4 protein is a key inhibitory receptor and a major negative regulator of T cell responses in coordination of immune regulation. Its unique property is its significantly increased affinity for B7 ligands (CD80/CD86) compared with CD28. CTLA-4 Protein, Human (HEK293) is the recombinant human-derived CTLA-4 protein, expressed by HEK293 , with tag free.

Product Specifications

Product Name Alternative

CTLA-4 Protein, Human (HEK293), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ctla-4-protein-human-hek293.html

Purity

95.0

Smiles

MACLGFQRHKAQLNLATRTWPCTLLFFLLFIPVFCKAMHVAQPAVVLASSRGIASFVCEYASPGKATEVRVTVLRQADSQVTEVCAATYMMGNELTFLDDSICTGTSSGNQVNLTIQGLRAMDTGLYICKVELMYPPPYYLGIGNGTQIYVIDPEPCPDSD

Molecular Formula

1493 (Gene_ID) P16410 (K36-D161) (Accession)

Molecular Weight

Approximately 13.5 kDa

Shipping Conditions

Dry ice

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ARTN ORF Vector (Human) (pORF)
ORF015834 1.0 µg DNA

ARTN ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
Bovine echolamine, CA ELISA Kit
MBS7244684-01 48 Well

Bovine echolamine, CA ELISA Kit

Sign In for Pricing
View Details
Bovine echolamine, CA ELISA Kit
MBS7244684-02 96 Well

Bovine echolamine, CA ELISA Kit

Sign In for Pricing
View Details
Bovine echolamine, CA ELISA Kit
MBS7244684-03 5x 96 Well

Bovine echolamine, CA ELISA Kit

Sign In for Pricing
View Details
Bovine echolamine, CA ELISA Kit
MBS7244684-04 10x 96 Well

Bovine echolamine, CA ELISA Kit

Sign In for Pricing
View Details
Apolipoprotein H (APOH) (NM_000042) Human Over-expression Lysate
LS000350 100 µg

Apolipoprotein H (APOH) (NM_000042) Human Over-expression Lysate

Sign In for Pricing
View Details