Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human E3 ubiquitin-protein ligase ZNRF3 (ZNRF3), partial

Product Specifications

Product Name Alternative

E3 ubiquitin-protein ligase ZNRF3 (EC 2.3.2.27) (RING finger protein 203) (RING-type E3 ubiquitin transferase ZNRF3) (Zinc/RING finger protein 3)

Abbreviation

Recombinant Human ZNRF3 protein, partial

Gene Name

ZNRF3

UniProt

Q9ULT6

Expression Region

56-219aa

Organism

Homo sapiens (Human)

Target Sequence

KETAFVEVVLFESSPSGDYTTYTTGLTGRFSRAGATLSAEGEIVQMHPLGLCNNNDEEDLYEYGWVGVVKLEQPELDPKPCLTVLGKAKRAVQRGATAVIFDVSENPEAIDQLNQGSEDPLKRPVVYVKGADAIKLMNIVNKQKVARARIQHRPPRQPTEYFDM

Tag

C-terminal 6xHis-tagged

Type

In Stock Protein

Source

Yeast

Field of Research

Epigenetics and Nuclear Signaling

Relevance

E3 ubiquitin-protein ligase that acts as a negative regulator of the Wnt signaling pathway by mediating the ubiquitination and subsequent degradation of Wnt receptor complex components Frizzled and LRP6. Acts on both canonical and non-canonical Wnt signaling pathway. Acts as a tumor suppressor in the intestinal stem cell zone by inhibiting the Wnt signaling pathway, thereby resticting the size of the intestinal stem cell zone (PubMed:22575959) . Along with RSPO2 and RNF43, constitutes a master switch that governs limb specification (By similarity) .

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

19.7 kDa

References & Citations

"Complete sequencing and characterization of 21,243 full-length human cDNAs."Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45 (2004)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human ABI gene family member 3, ABI3 ELISA KIT
ELI-24502h 96 Tests

Human ABI gene family member 3, ABI3 ELISA KIT

Sign In for Pricing
View Details
PARG Mouse Monoclonal Antibody [Clone ID: OTI1B5]
TA808508 100 µL

PARG Mouse Monoclonal Antibody [Clone ID: OTI1B5]

Sign In for Pricing
View Details
Recombinant Mouse HIST1H2BF Protein, His (Fc)-Avi-tagged
HIST1H2BF-4192M 50 µg

Recombinant Mouse HIST1H2BF Protein, His (Fc)-Avi-tagged

Sign In for Pricing
View Details
CD1a (Biotin) discontinued
C2252-01C-Biotin 100 µL

CD1a (Biotin) discontinued

Sign In for Pricing
View Details
CDK5RAP3 Recombinant Protein Antigen
NBP1-86780PEP 0.1 mL

CDK5RAP3 Recombinant Protein Antigen

Sign In for Pricing
View Details
Recombinant MPO Antibody
RC-4775-01 50 μL

Recombinant MPO Antibody

Sign In for Pricing
View Details