Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SCF, Mouse

SCF proteins are ligands for the KIT receptor-type protein tyrosine kinase and are critical for multiple cellular processes, including survival, proliferation, hematopoiesis, stem cell maintenance, gametogenesis, mast cell development, migration, and melanogenesis.Binding to KIT activates multiple signaling pathways involving PIK3R1, AKT1, GRB2, RAS, RAF1, MAP kinase, STAT family members and PLCG1, producing signaling molecules.SCF Protein, Mouse is the recombinant mouse-derived SCF protein, expressed by E.coli , with tag free.

Product Specifications

Product Name Alternative

SCF Protein, Mouse, Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/scf-protein-mouse.html

Purity

98.0

Smiles

KEICGNPVTDNVKDITKLVANLPNDYMITLNYVAGMDVLPSHCWLRDMVIQLSLSLTTLLDKFSNISEGLSNYSIIDKLGKIVDDLVLCMEENAPKNIKESPKRPETRSFTPEEFFSIFNRSIDAFKDFMVASDTSDCVLSSTLGPEKDSRVSVTKPFMLPPVA

Molecular Formula

17311 (Gene_ID) P20826 (K26-A189) (Accession)

Molecular Weight

Approximately 18 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Porcine C2 (Complement Component 2) ValidElisa Kit
EK345204 96 Well

Porcine C2 (Complement Component 2) ValidElisa Kit

Sign In for Pricing
View Details
RPS15AP26 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
42124061 1.0 µg DNA

RPS15AP26 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
KRTAP4-1 (NM_033060) Human Over-expression Lysate
LS085285-20ug 20 µg

KRTAP4-1 (NM_033060) Human Over-expression Lysate

Sign In for Pricing
View Details
SLC6A13 3'UTR Lenti-reporter-Luc Vector
44250081 1.0 µg

SLC6A13 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
Human SWI/SNF complex subunit SMARCC2, SMARCC2 ELISA KIT
ELI-19982h 96 Tests

Human SWI/SNF complex subunit SMARCC2, SMARCC2 ELISA KIT

Sign In for Pricing
View Details
Ndufs1 Rat Pre-designed siRNA Set A
HY-RS27678 1 Set

Ndufs1 Rat Pre-designed siRNA Set A

Sign In for Pricing
View Details