Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SCF, Mouse

SCF proteins are ligands for the KIT receptor-type protein tyrosine kinase and are critical for multiple cellular processes, including survival, proliferation, hematopoiesis, stem cell maintenance, gametogenesis, mast cell development, migration, and melanogenesis.Binding to KIT activates multiple signaling pathways involving PIK3R1, AKT1, GRB2, RAS, RAF1, MAP kinase, STAT family members and PLCG1, producing signaling molecules.SCF Protein, Mouse is the recombinant mouse-derived SCF protein, expressed by E.coli , with tag free.

Product Specifications

Product Name Alternative

SCF Protein, Mouse, Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/scf-protein-mouse.html

Purity

98.0

Smiles

KEICGNPVTDNVKDITKLVANLPNDYMITLNYVAGMDVLPSHCWLRDMVIQLSLSLTTLLDKFSNISEGLSNYSIIDKLGKIVDDLVLCMEENAPKNIKESPKRPETRSFTPEEFFSIFNRSIDAFKDFMVASDTSDCVLSSTLGPEKDSRVSVTKPFMLPPVA

Molecular Formula

17311 (Gene_ID) P20826 (K26-A189) (Accession)

Molecular Weight

Approximately 18 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

SH3GLB1 Antibody
A68954-100UG 100 µg

SH3GLB1 Antibody

Sign In for Pricing
View Details
PPM1F (Protein Phosphatase 1F (PP2C Domain Containing), CaMKPase, FEM-2, KIAA0015, POPX2, hFEM-2) (FITC)
MBS6178442-01 0.1 mL

PPM1F (Protein Phosphatase 1F (PP2C Domain Containing), CaMKPase, FEM-2, KIAA0015, POPX2, hFEM-2) (FITC)

Sign In for Pricing
View Details
PPM1F (Protein Phosphatase 1F (PP2C Domain Containing), CaMKPase, FEM-2, KIAA0015, POPX2, hFEM-2) (FITC)
MBS6178442-02 5x 0.1 mL

PPM1F (Protein Phosphatase 1F (PP2C Domain Containing), CaMKPase, FEM-2, KIAA0015, POPX2, hFEM-2) (FITC)

Sign In for Pricing
View Details
LYRM2 (NM_020466) Human Over-expression Lysate
LH11185V 100 µg

LYRM2 (NM_020466) Human Over-expression Lysate

Sign In for Pricing
View Details
Mouse Regulatory solute carrier protein family 1 member 1, RSC1A1 ELISA Kit
MBS9316284-01 48 Well

Mouse Regulatory solute carrier protein family 1 member 1, RSC1A1 ELISA Kit

Sign In for Pricing
View Details
Mouse Regulatory solute carrier protein family 1 member 1, RSC1A1 ELISA Kit
MBS9316284-02 96 Well

Mouse Regulatory solute carrier protein family 1 member 1, RSC1A1 ELISA Kit

Sign In for Pricing
View Details