What is the catalog number for NUP62 Rabbit Polyclonal Antibody?

The catalog number for NUP62 Rabbit Polyclonal Antibody is orb331391.

What sizes are available for NUP62 Rabbit Polyclonal Antibody?

NUP62 Rabbit Polyclonal Antibody is available in the following size(s): 100 µL.

Is NUP62 Rabbit Polyclonal Antibody in stock?

NUP62 Rabbit Polyclonal Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

NUP62 Rabbit Polyclonal Antibody

Rabbit polyclonal antibody to NUP72

Product Specifications

Product Name Alternative

Anti-A170 antibody, anti-EBI 3 associated protein of 60 kDa antibody, anti-EBI 3 associated protein p60 antibody, anti-EBI3 associated protein of 60 kDa antibody, anti-EBI3 associated protein p60 antibody, anti-EBI3-associated protein of 60 kDa antibody, anti-EBIAP antibody, anti-FTDALS3 antibody, anti-MGC127197 antibody, anti-ORCA antibody, anti-OSF-6 antibody, anti-Osi antibody, anti-OSIL antibody, anti-Oxidative stress induced like antibody, anti-p60 antibody, anti-p62 antibody, anti-p62B antibody, anti-Paget disease of bone 3 antibody, anti-PDB 3 antibody, anti-PDB3 antibody, anti-Phosphotyrosine independent ligand for the Lck SH2 domain of 62 kDa antibody, anti-Phosphotyrosine independent ligand for the Lck SH2 domain p62 antibody, anti-Phosphotyrosine-independent ligand for the Lck SH2 domain of 62 kDa antibody, anti-PKC-zeta-interacting protein antibody, anti-Protein kinase C-zeta-interacting protein antibody, anti-Sequestosome 1 antibody, anti-Sequestosome-1 antibody, anti-SQSTM 1 antibody, anti-SQSTM_HUMAN antibody, anti-Sqstm1 antibody, anti-STAP antibody, anti-STONE14 antibody, anti-Ubiquitin binding protein p62 antibody, anti-Ubiquitin-binding protein p62 antibody, anti-ZIP 3 antibody, anti-ZIP antibody, anti-ZIP3 antibody

UniProt

P37198

Reactivity

Human

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Human NUP62

Target

NUP62

Clonality

Polyclonal

Conjugation

Unconjugated

Sequence

Synthetic peptide located within the following region: TAPPGPGAAAGAAASSAMTYAQLESLINKWSLELEDQERHFLQQATQVNA

Field of Research

Cell Biology, Epigenetics & Chromatin, Signal Transduction

Purification

Affinity Purified

Concentration

0.5 mg/ml

Form

Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Molecular Weight

57kDa

Storage Conditions

Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.

Notes

For research use only.

Prediction Reactivity

Canine, Equine, Guinea pig, Mouse, Porcine, Rat

Tested Applications

NCBI Accession Number

NP_714941

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MBS9225052-01 0.5 mg

Phospho-p53(T18) Antibody Blocking peptide

View Details

MBS9225052-02 5x 0.5 mg

Phospho-p53(T18) Antibody Blocking peptide

View Details

A13834-2 2 mg

Linaclotide 2mg

View Details

MBS7223424-01 48 Well

Porcine AP20 region protein 1 (C3orf35) ELISA Kit

View Details

MBS7223424-02 96 Well

Porcine AP20 region protein 1 (C3orf35) ELISA Kit

View Details

MBS7223424-03 5x 96 Well

Porcine AP20 region protein 1 (C3orf35) ELISA Kit

View Details