Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Arginase-2/ARG2, Human (His)

Arginase-2/ARG2 Protein, Human (His) expresses in E. coli with a His tag at the N-terminus. Arginase-2 (Arg2) acts as a fasting-induced hepatocyte factor that protects against hepatic and peripheral fat accumulation, hepatic inflammatory responses, and insulin and glucose intolerance in obese murine models[1].

Product Specifications

Product Name Alternative

Arginase-2/ARG2 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/arginase-2-arg2-protein-human-his.html

Purity

98.0

Smiles

HSVAVIGAPFSQGQKRKGVEHGPAAIREAGLMKRLSSLGCHLKDFGDLSFTPVPKDDLYNNLIVNPRSVGLANQELAEVVSRAVSDGYSCVTLGGDHSLAIGTISGHARHCPDLCVVWVDAHADINTPLTTSSGNLHGQPVSFLLRELQDKVPQLPGFSWIKPCISSASIVYIGLRDVDPPEHFILKNYDIQYFSMRDIDRLGIQKVMERTFDLLIGKRQRPIHLSFDIDAFDPTLAPATGTPVVGGLTYREGMYIAEEIHNTGLLSALDLVEVNPQLATSEEEAKTTANLAVDVIASSFGQTREGGHHHHHH

Molecular Formula

384 (Gene_ID) P78540 (H24-G330) (Accession)

Molecular Weight

Approximately 33.0 kDa

References & Citations

[1]Yiming Zhang, et al. Hepatic arginase 2 (Arg2) is sufficient to convey the therapeutic metabolic effects of fasting. Nat Commun. 2019 Apr 8;10 (1) :1587.

Shipping Conditions

Dry ice.

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Chicken TGFb1 ELISA Kit
E100182-01 1 Each

Chicken TGFb1 ELISA Kit

Ask
View Details
Chicken TGFb1 ELISA Kit
E100182-02 1 Each

Chicken TGFb1 ELISA Kit

Ask
View Details
Hugh Leifson Medium
M826-100G 100 g

Hugh Leifson Medium

Ask
View Details
Junction cell adhesion molecule 2 (Jcam2) polyclonal antibody
ABP-PAB-10226 100 ug

Junction cell adhesion molecule 2 (Jcam2) polyclonal antibody

Ask
View Details
Colon cancer tissue array with normal colon tissue and adjacent colon tissue as control, including TNM and pathology grade with MMR (MLH1/PMS2/MSH2/MSH6 2017 Ventana MMR kit) IHC results,208 cases/ 208 cores, replacing CO20811
CO20811a 1 Each

Colon cancer tissue array with normal colon tissue and adjacent colon tissue as control, including TNM and pathology grade with MMR (MLH1/PMS2/MSH2/MSH6 2017 Ventana MMR kit) IHC results,208 cases/ 208 cores, replacing CO20811

Ask
View Details
PE Linked Monoclonal Antibody to Interleukin 8 (IL8)
MBS2128185-01 0.1 mL

PE Linked Monoclonal Antibody to Interleukin 8 (IL8)

Ask
View Details