Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD4, Ferret (HEK293, His)

CD4 Protein, an integral membrane glycoprotein, plays a pivotal role in immune responses. In T-cells, it serves as a coreceptor for MHC class II molecules, interacting with the T-cell receptor and initiating intracellular signaling pathways. In macrophages and NK cells, CD4 contributes to differentiation, cytokine expression, and cell migration independently of TCR/LCK. Additionally, CD4 is crucial in T-helper cell development, monocyte differentiation, and acts as the primary receptor for HIV-1, down-regulated by HIV-1 Vpu, and Human Herpesvirus 7/HHV-7. CD4 Protein, Ferret (HEK293, His) is the recombinant CD4 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

CD4 Protein, Ferret (HEK293, His), Others, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd4-protein-ferret-hek293-his.html

Purity

98.0

Smiles

REVVLGKVGDTAELPCNGSVGQNIVFNWMQSTVKILGRQINFWITGASKLKNRVESKKNLWDQGSFPLIIKNLEAADSGVYFCEVDGKKQAVELLVFNLTAKWNTGSSSGGSNIRLLQGQQLTLTVEAPSGSSPSVQWKGPGNKSKGSGHRLSLSGLDVQESGTWTCTISQNQKTVVFNINILVLGFQKVSNTVYSREGEQVKFSFPLNFEIEKLSGELRWRTEGAPSSLLWSSFTLENKKLFVKEVHHPRLQLKETLPLSFILPQASSQYAGSGTLTLSLAKGTLQQEVNLVVMRVTKFTNNLTCEVMGPTSPELTLSLNLEERAAKVSKQQKLVSVVEPEDGTWQCLLSDKDKVLLASKVEVLSPVFTKAWPKL

Molecular Formula

101684487 (Gene_ID) I6LI22 (R26-L401) (Accession)

Molecular Weight

Approximately 52 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

POF1B Antibody
A63515-100UG 100 µg

POF1B Antibody

Sign In for Pricing
View Details
Human CD82 (NM_001024844) AAV Particle
RC220072A1V 250 µL

Human CD82 (NM_001024844) AAV Particle

Sign In for Pricing
View Details
Alteminostat (CKD-581) 5mg
A24057-5 5 mg

Alteminostat (CKD-581) 5mg

Sign In for Pricing
View Details
Western Secondary Antibody Dilution Buffer
EZWB06-2-100mL 100 mL

Western Secondary Antibody Dilution Buffer

Sign In for Pricing
View Details
Comb for proPAGE - 15 Sample, 0.75mm thick, pk/5
CVS8-15-0.75 5 PCS/Pack

Comb for proPAGE - 15 Sample, 0.75mm thick, pk/5

Sign In for Pricing
View Details
CASP10 (Caspase 10, Apoptosis-Related Cysteine Peptidase, ALPS2, FLICE2, MCH4) (PE)
244239-PE 100 µL

CASP10 (Caspase 10, Apoptosis-Related Cysteine Peptidase, ALPS2, FLICE2, MCH4) (PE)

Sign In for Pricing
View Details