Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD4, Ferret (HEK293, His)

CD4 Protein, an integral membrane glycoprotein, plays a pivotal role in immune responses. In T-cells, it serves as a coreceptor for MHC class II molecules, interacting with the T-cell receptor and initiating intracellular signaling pathways. In macrophages and NK cells, CD4 contributes to differentiation, cytokine expression, and cell migration independently of TCR/LCK. Additionally, CD4 is crucial in T-helper cell development, monocyte differentiation, and acts as the primary receptor for HIV-1, down-regulated by HIV-1 Vpu, and Human Herpesvirus 7/HHV-7. CD4 Protein, Ferret (HEK293, His) is the recombinant CD4 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

CD4 Protein, Ferret (HEK293, His), Others, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd4-protein-ferret-hek293-his.html

Purity

98.0

Smiles

REVVLGKVGDTAELPCNGSVGQNIVFNWMQSTVKILGRQINFWITGASKLKNRVESKKNLWDQGSFPLIIKNLEAADSGVYFCEVDGKKQAVELLVFNLTAKWNTGSSSGGSNIRLLQGQQLTLTVEAPSGSSPSVQWKGPGNKSKGSGHRLSLSGLDVQESGTWTCTISQNQKTVVFNINILVLGFQKVSNTVYSREGEQVKFSFPLNFEIEKLSGELRWRTEGAPSSLLWSSFTLENKKLFVKEVHHPRLQLKETLPLSFILPQASSQYAGSGTLTLSLAKGTLQQEVNLVVMRVTKFTNNLTCEVMGPTSPELTLSLNLEERAAKVSKQQKLVSVVEPEDGTWQCLLSDKDKVLLASKVEVLSPVFTKAWPKL

Molecular Formula

101684487 (Gene_ID) I6LI22 (R26-L401) (Accession)

Molecular Weight

Approximately 52 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Magic™ Human CLDN18.1 HEK293T Cell Line
S01YF-0123-KX302 1 Vial

Magic™ Human CLDN18.1 HEK293T Cell Line

Sign In for Pricing
View Details
FBXL10b, NT (KDM2B, CXXC2, FBL10, FBXL10, JHDM1B, PCCX2, Lysine-specific demethylase 2B, CXXC-type zinc finger protein 2, F-box and leucine-rich repeat protein 10, F-box protein FBL10, F-box/LRR-repeat protein 10, JmjC domain-containing histone demethylation protein 1B, Jumonji domain-containing EMSY-interactor methyltransferase motif protein, Protein-containing CXXC domain 2, [Histone-H3]-lysine-36 demethylase 1B) (MaxLight 650) discontinued
035537-ML650 100 µL

FBXL10b, NT (KDM2B, CXXC2, FBL10, FBXL10, JHDM1B, PCCX2, Lysine-specific demethylase 2B, CXXC-type zinc finger protein 2, F-box and leucine-rich repeat protein 10, F-box protein FBL10, F-box/LRR-repeat protein 10, JmjC domain-containing histone demethylation protein 1B, Jumonji domain-containing EMSY-interactor methyltransferase motif protein, Protein-containing CXXC domain 2, [Histone-H3]-lysine-36 demethylase 1B) (MaxLight 650) discontinued

Sign In for Pricing
View Details
Human Hdv Antibody IgM ELISA Kit
BG-HUM11140 1 Each

Human Hdv Antibody IgM ELISA Kit

Sign In for Pricing
View Details
ALG14 ORF Vector (Human) (pORF)
ORF000343 1.0 µg DNA

ALG14 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
Tissue, Section, Human Disease, Diabetes, Skeletal Muscle (Paraffin) HisTekTM
T5595-5122M1 5 Slides

Tissue, Section, Human Disease, Diabetes, Skeletal Muscle (Paraffin) HisTekTM

Sign In for Pricing
View Details
ADA siRNA (Mouse)
CRM0053-01 15 nmol

ADA siRNA (Mouse)

Sign In for Pricing
View Details