Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD4, Ferret (HEK293, His)

CD4 Protein, an integral membrane glycoprotein, plays a pivotal role in immune responses. In T-cells, it serves as a coreceptor for MHC class II molecules, interacting with the T-cell receptor and initiating intracellular signaling pathways. In macrophages and NK cells, CD4 contributes to differentiation, cytokine expression, and cell migration independently of TCR/LCK. Additionally, CD4 is crucial in T-helper cell development, monocyte differentiation, and acts as the primary receptor for HIV-1, down-regulated by HIV-1 Vpu, and Human Herpesvirus 7/HHV-7. CD4 Protein, Ferret (HEK293, His) is the recombinant CD4 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

CD4 Protein, Ferret (HEK293, His), Others, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd4-protein-ferret-hek293-his.html

Purity

98.0

Smiles

REVVLGKVGDTAELPCNGSVGQNIVFNWMQSTVKILGRQINFWITGASKLKNRVESKKNLWDQGSFPLIIKNLEAADSGVYFCEVDGKKQAVELLVFNLTAKWNTGSSSGGSNIRLLQGQQLTLTVEAPSGSSPSVQWKGPGNKSKGSGHRLSLSGLDVQESGTWTCTISQNQKTVVFNINILVLGFQKVSNTVYSREGEQVKFSFPLNFEIEKLSGELRWRTEGAPSSLLWSSFTLENKKLFVKEVHHPRLQLKETLPLSFILPQASSQYAGSGTLTLSLAKGTLQQEVNLVVMRVTKFTNNLTCEVMGPTSPELTLSLNLEERAAKVSKQQKLVSVVEPEDGTWQCLLSDKDKVLLASKVEVLSPVFTKAWPKL

Molecular Formula

101684487 (Gene_ID) I6LI22 (R26-L401) (Accession)

Molecular Weight

Approximately 52 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

EPHA2 Protein Vector (Human) (pPB-C-His)
PV075705 500 ng

EPHA2 Protein Vector (Human) (pPB-C-His)

Sign In for Pricing
View Details
Mouse Apoptotic Peptidase Activating Factor 1 APAF1 ELISA Kit
BG-MUS10191 1 Each

Mouse Apoptotic Peptidase Activating Factor 1 APAF1 ELISA Kit

Sign In for Pricing
View Details
APP (Y756) (APP, A4, AD1, Amyloid beta A4 protein, ABPP, APPI, Alzheimer disease amyloid protein, Cerebral vascular amyloid peptide, PreA4, Protease nexin-II, N-APP, Soluble APP-alpha, Soluble APP-beta, C99, Beta-amyloid protein 42, Beta-APP42, Beta-amyloid protein 40, Beta-APP40, C83, P3 (42), P3 (40), C80, Gamma-secretase C-terminal fragment 59, Amyloid intracellular domain 59, Gamma-CTF (59), Gamma-secretase C-terminal fragment 57, Amyloid intracellular domain 57, Gamma-CTF (57), Gamma-secretase C-terminal fragment 50, Amyloid intracellular domain 50, Gamma-CTF (50), C31) (MaxLight 490) discontinued
031995-ML490 100 µL

APP (Y756) (APP, A4, AD1, Amyloid beta A4 protein, ABPP, APPI, Alzheimer disease amyloid protein, Cerebral vascular amyloid peptide, PreA4, Protease nexin-II, N-APP, Soluble APP-alpha, Soluble APP-beta, C99, Beta-amyloid protein 42, Beta-APP42, Beta-amyloid protein 40, Beta-APP40, C83, P3 (42), P3 (40), C80, Gamma-secretase C-terminal fragment 59, Amyloid intracellular domain 59, Gamma-CTF (59), Gamma-secretase C-terminal fragment 57, Amyloid intracellular domain 57, Gamma-CTF (57), Gamma-secretase C-terminal fragment 50, Amyloid intracellular domain 50, Gamma-CTF (50), C31) (MaxLight 490) discontinued

Sign In for Pricing
View Details
Rabbit anti-GDF7 Antibody
YLD3371-01 50 µL

Rabbit anti-GDF7 Antibody

Sign In for Pricing
View Details
Rabbit anti-GDF7 Antibody
YLD3371-02 100 µL

Rabbit anti-GDF7 Antibody

Sign In for Pricing
View Details
pCMV-SPORT6.ccdb-Mmp11 Plasmid
PVT40571 2 µg

pCMV-SPORT6.ccdb-Mmp11 Plasmid

Sign In for Pricing
View Details