Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD4, Ferret (HEK293, His)

CD4 Protein, an integral membrane glycoprotein, plays a pivotal role in immune responses. In T-cells, it serves as a coreceptor for MHC class II molecules, interacting with the T-cell receptor and initiating intracellular signaling pathways. In macrophages and NK cells, CD4 contributes to differentiation, cytokine expression, and cell migration independently of TCR/LCK. Additionally, CD4 is crucial in T-helper cell development, monocyte differentiation, and acts as the primary receptor for HIV-1, down-regulated by HIV-1 Vpu, and Human Herpesvirus 7/HHV-7. CD4 Protein, Ferret (HEK293, His) is the recombinant CD4 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

CD4 Protein, Ferret (HEK293, His), Others, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd4-protein-ferret-hek293-his.html

Purity

98.0

Smiles

REVVLGKVGDTAELPCNGSVGQNIVFNWMQSTVKILGRQINFWITGASKLKNRVESKKNLWDQGSFPLIIKNLEAADSGVYFCEVDGKKQAVELLVFNLTAKWNTGSSSGGSNIRLLQGQQLTLTVEAPSGSSPSVQWKGPGNKSKGSGHRLSLSGLDVQESGTWTCTISQNQKTVVFNINILVLGFQKVSNTVYSREGEQVKFSFPLNFEIEKLSGELRWRTEGAPSSLLWSSFTLENKKLFVKEVHHPRLQLKETLPLSFILPQASSQYAGSGTLTLSLAKGTLQQEVNLVVMRVTKFTNNLTCEVMGPTSPELTLSLNLEERAAKVSKQQKLVSVVEPEDGTWQCLLSDKDKVLLASKVEVLSPVFTKAWPKL

Molecular Formula

101684487 (Gene_ID) I6LI22 (R26-L401) (Accession)

Molecular Weight

Approximately 52 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

C1QB Protein Vector (Mouse) (pPM-C-His)
PV160325 500 ng

C1QB Protein Vector (Mouse) (pPM-C-His)

Sign In for Pricing
View Details
Plant Adenosine A1 Receptor (ADORA1) ELISA Kit
MBS9379540 Inquire

Plant Adenosine A1 Receptor (ADORA1) ELISA Kit

Sign In for Pricing
View Details
PTPLAD2 Protein Vector (Mouse) (pPB-N-His)
PV220835 500 ng

PTPLAD2 Protein Vector (Mouse) (pPB-N-His)

Sign In for Pricing
View Details
pEGFP-N1-IL10 Plasmid
PVT7214 2 µg

pEGFP-N1-IL10 Plasmid

Sign In for Pricing
View Details
IgG, kappa discontinued
I1906-25 50 µg

IgG, kappa discontinued

Sign In for Pricing
View Details
Htr6 (NM_024365) Rat Untagged Clone
RN211220 10 µg

Htr6 (NM_024365) Rat Untagged Clone

Sign In for Pricing
View Details