Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD4, Ferret (HEK293, His)

CD4 Protein, an integral membrane glycoprotein, plays a pivotal role in immune responses. In T-cells, it serves as a coreceptor for MHC class II molecules, interacting with the T-cell receptor and initiating intracellular signaling pathways. In macrophages and NK cells, CD4 contributes to differentiation, cytokine expression, and cell migration independently of TCR/LCK. Additionally, CD4 is crucial in T-helper cell development, monocyte differentiation, and acts as the primary receptor for HIV-1, down-regulated by HIV-1 Vpu, and Human Herpesvirus 7/HHV-7. CD4 Protein, Ferret (HEK293, His) is the recombinant CD4 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

CD4 Protein, Ferret (HEK293, His), Others, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd4-protein-ferret-hek293-his.html

Purity

98.0

Smiles

REVVLGKVGDTAELPCNGSVGQNIVFNWMQSTVKILGRQINFWITGASKLKNRVESKKNLWDQGSFPLIIKNLEAADSGVYFCEVDGKKQAVELLVFNLTAKWNTGSSSGGSNIRLLQGQQLTLTVEAPSGSSPSVQWKGPGNKSKGSGHRLSLSGLDVQESGTWTCTISQNQKTVVFNINILVLGFQKVSNTVYSREGEQVKFSFPLNFEIEKLSGELRWRTEGAPSSLLWSSFTLENKKLFVKEVHHPRLQLKETLPLSFILPQASSQYAGSGTLTLSLAKGTLQQEVNLVVMRVTKFTNNLTCEVMGPTSPELTLSLNLEERAAKVSKQQKLVSVVEPEDGTWQCLLSDKDKVLLASKVEVLSPVFTKAWPKL

Molecular Formula

101684487 (Gene_ID) I6LI22 (R26-L401) (Accession)

Molecular Weight

Approximately 52 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

YIPF5 (NM_030799) Human Tagged Lenti ORF Clone
RC203192L1 10 µg

YIPF5 (NM_030799) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Opn5 Rat shRNA Lentiviral Particle (Locus ID 316259)
TL713570V 500 µL Each

Opn5 Rat shRNA Lentiviral Particle (Locus ID 316259)

Sign In for Pricing
View Details
Rat Myo1e Pre-designed siRNA Set A
SI208941A 1 Each

Rat Myo1e Pre-designed siRNA Set A

Sign In for Pricing
View Details
NKp30 (NCR3, Natural Cytotoxicity Receptor)
216855 100 µg

NKp30 (NCR3, Natural Cytotoxicity Receptor)

Sign In for Pricing
View Details
APC-Linked Polyclonal Antibody to Dipeptidase 2 (DPEP2)
MBS2076444-01 0.1 mL

APC-Linked Polyclonal Antibody to Dipeptidase 2 (DPEP2)

Sign In for Pricing
View Details
APC-Linked Polyclonal Antibody to Dipeptidase 2 (DPEP2)
MBS2076444-02 0.2 mL

APC-Linked Polyclonal Antibody to Dipeptidase 2 (DPEP2)

Sign In for Pricing
View Details