Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD4, Ferret (HEK293, His)

CD4 Protein, an integral membrane glycoprotein, plays a pivotal role in immune responses. In T-cells, it serves as a coreceptor for MHC class II molecules, interacting with the T-cell receptor and initiating intracellular signaling pathways. In macrophages and NK cells, CD4 contributes to differentiation, cytokine expression, and cell migration independently of TCR/LCK. Additionally, CD4 is crucial in T-helper cell development, monocyte differentiation, and acts as the primary receptor for HIV-1, down-regulated by HIV-1 Vpu, and Human Herpesvirus 7/HHV-7. CD4 Protein, Ferret (HEK293, His) is the recombinant CD4 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

CD4 Protein, Ferret (HEK293, His), Others, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd4-protein-ferret-hek293-his.html

Purity

98.0

Smiles

REVVLGKVGDTAELPCNGSVGQNIVFNWMQSTVKILGRQINFWITGASKLKNRVESKKNLWDQGSFPLIIKNLEAADSGVYFCEVDGKKQAVELLVFNLTAKWNTGSSSGGSNIRLLQGQQLTLTVEAPSGSSPSVQWKGPGNKSKGSGHRLSLSGLDVQESGTWTCTISQNQKTVVFNINILVLGFQKVSNTVYSREGEQVKFSFPLNFEIEKLSGELRWRTEGAPSSLLWSSFTLENKKLFVKEVHHPRLQLKETLPLSFILPQASSQYAGSGTLTLSLAKGTLQQEVNLVVMRVTKFTNNLTCEVMGPTSPELTLSLNLEERAAKVSKQQKLVSVVEPEDGTWQCLLSDKDKVLLASKVEVLSPVFTKAWPKL

Molecular Formula

101684487 (Gene_ID) I6LI22 (R26-L401) (Accession)

Molecular Weight

Approximately 52 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

HLA DRB4 Rabbit Monoclonal Antibody
E49D1152 100 µL

HLA DRB4 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Human FAM89B activation kit by CRISPRa
GA108443 1 Kit

Human FAM89B activation kit by CRISPRa

Sign In for Pricing
View Details
Rat Grip2 Pre-designed siRNA Set B
SI205939B 1 Each

Rat Grip2 Pre-designed siRNA Set B

Sign In for Pricing
View Details
LONP2 Knockout AGS Polyclonal Cells
ARG3005 1 Million

LONP2 Knockout AGS Polyclonal Cells

Sign In for Pricing
View Details
SLC44A3 Blocking Peptide
33R-6087 100 ug

SLC44A3 Blocking Peptide

Sign In for Pricing
View Details
PARP3 Protein Vector (Rat) (pPB-C-His)
PV292462 500 ng

PARP3 Protein Vector (Rat) (pPB-C-His)

Sign In for Pricing
View Details