Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD4, Ferret (HEK293, His)

CD4 Protein, an integral membrane glycoprotein, plays a pivotal role in immune responses. In T-cells, it serves as a coreceptor for MHC class II molecules, interacting with the T-cell receptor and initiating intracellular signaling pathways. In macrophages and NK cells, CD4 contributes to differentiation, cytokine expression, and cell migration independently of TCR/LCK. Additionally, CD4 is crucial in T-helper cell development, monocyte differentiation, and acts as the primary receptor for HIV-1, down-regulated by HIV-1 Vpu, and Human Herpesvirus 7/HHV-7. CD4 Protein, Ferret (HEK293, His) is the recombinant CD4 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

CD4 Protein, Ferret (HEK293, His), Others, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd4-protein-ferret-hek293-his.html

Purity

98.0

Smiles

REVVLGKVGDTAELPCNGSVGQNIVFNWMQSTVKILGRQINFWITGASKLKNRVESKKNLWDQGSFPLIIKNLEAADSGVYFCEVDGKKQAVELLVFNLTAKWNTGSSSGGSNIRLLQGQQLTLTVEAPSGSSPSVQWKGPGNKSKGSGHRLSLSGLDVQESGTWTCTISQNQKTVVFNINILVLGFQKVSNTVYSREGEQVKFSFPLNFEIEKLSGELRWRTEGAPSSLLWSSFTLENKKLFVKEVHHPRLQLKETLPLSFILPQASSQYAGSGTLTLSLAKGTLQQEVNLVVMRVTKFTNNLTCEVMGPTSPELTLSLNLEERAAKVSKQQKLVSVVEPEDGTWQCLLSDKDKVLLASKVEVLSPVFTKAWPKL

Molecular Formula

101684487 (Gene_ID) I6LI22 (R26-L401) (Accession)

Molecular Weight

Approximately 52 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Krueppel-Like Factor 3 (KLF3) Peptide
abx269146 100 µg

Krueppel-Like Factor 3 (KLF3) Peptide

Sign In for Pricing
View Details
Recombinant Human LpPLA2/PLA2G7/PAF-AH Protein, N-His
YHG39701 100 μg

Recombinant Human LpPLA2/PLA2G7/PAF-AH Protein, N-His

Sign In for Pricing
View Details
CD40L (CD40LG) (NM_000074) Human Over-expression Lysate
LS000959-100ug 100 µg

CD40L (CD40LG) (NM_000074) Human Over-expression Lysate

Sign In for Pricing
View Details
TFPT sgRNA CRISPR Lentivector (Human) (Target 3)
K2363504 1.0 µg DNA

TFPT sgRNA CRISPR Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
Rabbit IFN-α-Ab ELISA Kit
ERTI0048 96 Tests

Rabbit IFN-α-Ab ELISA Kit

Sign In for Pricing
View Details
COX16 Human qPCR Template Standard (NM_016468)
HK201237 1 Kit

COX16 Human qPCR Template Standard (NM_016468)

Sign In for Pricing
View Details