Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD4, Ferret (HEK293, His)

CD4 Protein, an integral membrane glycoprotein, plays a pivotal role in immune responses. In T-cells, it serves as a coreceptor for MHC class II molecules, interacting with the T-cell receptor and initiating intracellular signaling pathways. In macrophages and NK cells, CD4 contributes to differentiation, cytokine expression, and cell migration independently of TCR/LCK. Additionally, CD4 is crucial in T-helper cell development, monocyte differentiation, and acts as the primary receptor for HIV-1, down-regulated by HIV-1 Vpu, and Human Herpesvirus 7/HHV-7. CD4 Protein, Ferret (HEK293, His) is the recombinant CD4 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

CD4 Protein, Ferret (HEK293, His), Others, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd4-protein-ferret-hek293-his.html

Purity

98.0

Smiles

REVVLGKVGDTAELPCNGSVGQNIVFNWMQSTVKILGRQINFWITGASKLKNRVESKKNLWDQGSFPLIIKNLEAADSGVYFCEVDGKKQAVELLVFNLTAKWNTGSSSGGSNIRLLQGQQLTLTVEAPSGSSPSVQWKGPGNKSKGSGHRLSLSGLDVQESGTWTCTISQNQKTVVFNINILVLGFQKVSNTVYSREGEQVKFSFPLNFEIEKLSGELRWRTEGAPSSLLWSSFTLENKKLFVKEVHHPRLQLKETLPLSFILPQASSQYAGSGTLTLSLAKGTLQQEVNLVVMRVTKFTNNLTCEVMGPTSPELTLSLNLEERAAKVSKQQKLVSVVEPEDGTWQCLLSDKDKVLLASKVEVLSPVFTKAWPKL

Molecular Formula

101684487 (Gene_ID) I6LI22 (R26-L401) (Accession)

Molecular Weight

Approximately 52 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

MMP-9-IN-1 10mg
A24454-10 10 mg

MMP-9-IN-1 10mg

Sign In for Pricing
View Details
MT2P1 3'UTR Luciferase Stable Cell Line
TU014845 1.0 mL

MT2P1 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
GTF2F2 antibody - middle region
MBS3200434-01 0.1 mL

GTF2F2 antibody - middle region

Sign In for Pricing
View Details
GTF2F2 antibody - middle region
MBS3200434-02 5x 0.1 mL

GTF2F2 antibody - middle region

Sign In for Pricing
View Details
Olr1236 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 1)
K7485706 1.0 µg DNA

Olr1236 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 1)

Sign In for Pricing
View Details
UNC 1215
2252-1 1 mg

UNC 1215

Sign In for Pricing
View Details