Question 1

What is the catalog number for Mouse Cfd Pre-designed siRNA Set B?

Accepted Answer

The catalog number for Mouse Cfd Pre-designed siRNA Set B is SI102471B.

Question 2

What sizes are available for Mouse Cfd Pre-designed siRNA Set B?

Accepted Answer

Mouse Cfd Pre-designed siRNA Set B is available in the following size(s): 1 Each.

Question 3

Is Mouse Cfd Pre-designed siRNA Set B in stock?

Accepted Answer

Mouse Cfd Pre-designed siRNA Set B is currently made to order / not held in immediate stock. Contact us for lead time.

Question 4

Do you provide a Certificate of Analysis (CoA) for this product?

Accepted Answer

A Certificate of Analysis is available for most products upon request. Contact our support team with the lot number to obtain the relevant CoA.

Question 5

Is this product suitable for live cell imaging?

Accepted Answer

Suitability for live cell imaging depends on the specific reagent and conjugate used. Check the datasheet for imaging-specific validation, or contact us for guidance.

Question 6

Is this product covered by a money-back guarantee?

Accepted Answer

Yes, we guarantee a full refund or store credit if this product arrives damaged beyond usability, or has a genuine performance issue under proper usage and storage, provided you report it immediately with evidence. Claims after the expiration date or due to improper storage after receipt are excluded.

Mouse Cfd Pre-designed siRNA Set B

Product Specifications

Short Description

Gene Name

Gene Aliases

Gene ID

Purification Method

Shipping Conditions

Storage Conditions

Shelf Life

Species

Frequently Asked Questions

Explore Other Products

CD31 (PECAM-1, EndoCAM, PECA1, Platelet Endothelial Cell Adhesion Molecule 1, GPIIA)

Rabbit Polyclonal Caspase-4 Antibody [mFluor Violet 500 SE]

AKT2 (specific) (incl. pos. control) Mouse Monoclonal Antibody [Clone ID: 8B7]

Purified Anti-Human CD45 (HI30)

Mouse Monoclonal PD-1 Antibody (7A11B1)

H-HSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNRNNIA-OH