Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Ephrin-B1/EFNB1, Mouse (HEK293, Fc)

Ephrin-B1 (EFNB1) protein binds to Eph family receptors, enabling signaling between receptor-expressing cells and cells with EFNB1. It is crucial for neuronal axon growth and expressed in various tissues like the adult lung and colon, highlighting its widespread presence and importance in mediating cellular interactions. Ephrin-B1/EFNB1 Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived Ephrin-B1/EFNB1 protein, expressed by HEK293 , with C-hFc labeled tag.

Product Specifications

Product Name Alternative

Ephrin-B1/EFNB1 Protein, Mouse (HEK293, Fc), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ephrin-b1-efnb1-protein-mouse-hek293-fc.html

Purity

95.00

Smiles

KNLEPVSWSSLNPKFLSGKGLVIYPKIGDKLDIICPRAEAGRPYEYYKLYLVRPEQAAACSTVLDPNVLVTCNKPHQEIRFTIKFQEFSPNYMGLEFKKYHDYYITSTSNGSLEGLENREGGVCRTRTMKIVMKVGQDPNAVTPEQLTTSRPSKESDNTVKTATQAPGRGSQGDSDGKHETVNQEEKSGPGAGGGGSGDS

Molecular Formula

13641 (Gene_ID) NP_034240.1 (K30-S229) (Accession)

Molecular Weight

55-75 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Pmel17 / gp100 / SILV (NKI-beteb), CF740 conjugate, 0.1mg/mL
BNC740226-500 1x 500 µL

Pmel17 / gp100 / SILV (NKI-beteb), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ep-CAM / CD326 (VU-1D9), CF640R conjugate, 0.1mg/mL
BNC400017-100 1x 100 µL

Ep-CAM / CD326 (VU-1D9), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Von Willebrand Factor (3E2D10), CF640R conjugate, 0.1mg/mL
BNC400633-100 1x 100 µL

Von Willebrand Factor (3E2D10), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD74 (BU45), CF647 conjugate, 0.1mg/mL
BNC470189-100 1x 100 µL

CD74 (BU45), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD34 (ICO-115), CF594 conjugate, 0.1mg/mL
BNC940039-100 1x 100 µL

CD34 (ICO-115), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD35 / CR1 (E11), CF647 conjugate, 0.1mg/mL
BNC470040-500 1x 500 µL

CD35 / CR1 (E11), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details