Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Transforming growth factor beta-3 (TGFB3) (Y340F), partial (Active)

Product Specifications

Product Name Alternative

Transforming growth factor beta-3; TGFB3; TGF-beta-3; Latency-associated peptide; LAP

Abbreviation

Recombinant Human TGFB3 protein (Y340F), partial (Active)

Gene Name

TGFB3

UniProt

P10600

Expression Region

301-412aa (Y340F)

Organism

Homo sapiens (Human)

Target Sequence

ALDTNYCFRNLEENCCVRPLYIDFRQDLGWKWVHEPKGYFANFCSGPCPYLRSADTTHSTVLGLYNTLNPEASASPCCVPQDLEPLTILYYVGRTPKVEQLSNMVVKSCKCS

Tag

Tag-Free

Type

Active Protein & In Stock Protein

Source

Mammalian cell

Field of Research

Cancer

Relevance

Transforming growth factor beta 3 (TGFB3) is a member of a TGF -β superfamily which is defined by theirstructural and functional similarities. TGFB3 is secreted as a complex with LAP. This latent form of TGFB3becomes active upon cleavage by plasmin, matrix metalloproteases, thrombospondin -1, and a subset ofintegrins. It binds with high affinity to TGF- β RII, a type II serine/threonine kinase receptor. TGFB3 is involved incell differentiation, embryogenesis and development.It is believed to regulate molecules involved in cellularadhesion and extracellular matrix (ECM) formation during the process of palate development. Without TGF-β3, mammals develop a deformity known as a cleft palate.

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

Greater than 95% as determined by SDS-PAGE.

Activity

Yes

Bioactivity

The ED50 as determined by its ability to inhibit the IL-4-dependent proliferation of TF-1 mouse T cells is 10-80 pg/ml.

Form

Lyophilized powder

Buffer

Lyophilized from a 0.2 μm filtered solution of 50mM Glycine-HCl, 150mM NaCl, pH2.5.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Involved in embryogenesis and cell differentiation.

Molecular Weight

12.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human SMTNL1 activation kit by CRISPRa
GA116498 1 Kit

Human SMTNL1 activation kit by CRISPRa

Sign In for Pricing
View Details
ENAH / MENA (Actin Regulator) (ENAH/1988), CF568 conjugate, 0.1mg/mL
BNC681988-500 1x 500 µL

ENAH / MENA (Actin Regulator) (ENAH/1988), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Frozen Tissue Sections, Endometrium
CS623285 5x 5 µm

Frozen Tissue Sections, Endometrium

Sign In for Pricing
View Details
FHIT Polyclonal Antibody
E-AB-15035-01 20 µL

FHIT Polyclonal Antibody

Sign In for Pricing
View Details
FHIT Polyclonal Antibody
E-AB-15035-02 60 µL

FHIT Polyclonal Antibody

Sign In for Pricing
View Details
FHIT Polyclonal Antibody
E-AB-15035-03 120 µL

FHIT Polyclonal Antibody

Sign In for Pricing
View Details