Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KLRB1F/CD161f, Mouse (HEK293, Fc)

The KLRB1F/CD161f protein is thought to bind CLEC2I/Clr-g, activate natural killer cells and provide costimulation for IL-2 production and T cell proliferation. This dual function highlights its critical role in coordinating immune responses. KLRB1F/CD161f Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived KLRB1F/CD161f protein, expressed by HEK293 , with N-hFc labeled tag.

Product Specifications

Product Name Alternative

KLRB1F/CD161f Protein, Mouse (HEK293, Fc), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/klrb1f-cd161f-protein-mouse-hek293-fc.html

Purity

97.00

Smiles

QKPPIEKCSVAAQENRTELTGRSAILECPRYWHPHWNKCLFVSQISRPWAEGRDACSMEDAILLLIENKEELRFVQNLIKGKEQLFFIGLKYVQKEKIWKWIDGSILNPNLLRITGKDKENSCAIISHTEVFSDSCSSDNHWICQKTLIHV

Molecular Formula

232408 (Gene_ID) Q8VD98 (Q67-V217) (Accession)

Molecular Weight

Approximately 50-55 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

D.Aspartic acid Rabbit Polyclonal Antibody (BF750)
orb2382738 100 µL

D.Aspartic acid Rabbit Polyclonal Antibody (BF750)

Sign In for Pricing
View Details
FAUP3 CRISPRa sgRNA lentivector (set of three targets)(Human)
20271121 3x 1.0µg DNA

FAUP3 CRISPRa sgRNA lentivector (set of three targets)(Human)

Sign In for Pricing
View Details
Duck Leukocyte Immunoglobulin-Like Receptor Subfamily A Member 5 (LILRA5) ELISA Kit
MBS9920279 Inquire

Duck Leukocyte Immunoglobulin-Like Receptor Subfamily A Member 5 (LILRA5) ELISA Kit

Sign In for Pricing
View Details
SPG11 Antibody
254020 0.1 mg

SPG11 Antibody

Sign In for Pricing
View Details
GALNS antibody
FNab03322 100 µg

GALNS antibody

Sign In for Pricing
View Details
TUG-770
B1166-5 5 mg

TUG-770

Sign In for Pricing
View Details