Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Epigen protein (EPGN), partial (Active)

Product Specifications

Product Name Alternative

Epithelial mitogen

Abbreviation

Recombinant Human EPGN protein, partial (Active)

Gene Name

EPGN

UniProt

Q6UW88

Expression Region

24-95aa

Organism

Homo sapiens (Human)

Target Sequence

AVTVTPPITAQQADNIEGPIALKFSHLCLEDHNSYCINGACAFHHELEKAICRCFTGYTGERCEHLTLTSYA

Tag

Tag-Free

Type

Active Protein & In Stock Protein

Source

E.Coli

Field of Research

Cancer

Relevance

Promotes the growth of epithelial cells. May stimulate the phosphorylation of EGFR and mitogen-activated protein kinases. {ECO:0000269|PubMed:15611079}.

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

>98% as determined by SDS-PAGE.

Activity

Yes

Bioactivity

Fully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using murine Balb/c 3T3 cells is less than 300 ng/ml, corresponding to a specific activity of > 3.3 x 103 IU/mg.

Form

Lyophilized powder

Buffer

Lyophilized from a 0.2 µm filtered PBS, pH 7.4

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Promotes the growth of epithelial cells. May stimulate the phosphorylation of EGFR and mitogen-activated protein kinases.

Molecular Weight

7.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial of Isoform 2

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Klra6 Protein Vector (Mouse) (pPM-C-HA)
PV194980 500 ng

Klra6 Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
ATXN1 Conjugated Antibody
C36271 100 µL

ATXN1 Conjugated Antibody

Sign In for Pricing
View Details
Dystonin (230kD bullous pemphigoid antigen, BP240, BPA, BPAG1, Bullous pemphigoid antigen, Bullous pemphigoid antigen 1, isoform 7, Bullous pemphigoid antigen 1, isoforms 1/2/3/4/5/8, Bullous pemphigoid antigen 1, Isoforms 6/9/10, CATX-15, D6S1101, DKFZp564B2416, DMH, DT, Dystonia Musculorum Protein, Dystonin, FLJ13425, FLJ21489, FLJ30627, FLJ32235, FLJ46791, Hemidesmosomal Plaque Protein, KIAA0465, KIAA0728, KIAA1470, MACF2, Trabeculin-beta) (AP) discontinued
D9906-AP 100 µL

Dystonin (230kD bullous pemphigoid antigen, BP240, BPA, BPAG1, Bullous pemphigoid antigen, Bullous pemphigoid antigen 1, isoform 7, Bullous pemphigoid antigen 1, isoforms 1/2/3/4/5/8, Bullous pemphigoid antigen 1, Isoforms 6/9/10, CATX-15, D6S1101, DKFZp564B2416, DMH, DT, Dystonia Musculorum Protein, Dystonin, FLJ13425, FLJ21489, FLJ30627, FLJ32235, FLJ46791, Hemidesmosomal Plaque Protein, KIAA0465, KIAA0728, KIAA1470, MACF2, Trabeculin-beta) (AP) discontinued

Sign In for Pricing
View Details
METTL20 Protein Vector (Rat) (pPM-C-HA)
28404026 500 ng

METTL20 Protein Vector (Rat) (pPM-C-HA)

Sign In for Pricing
View Details
Mouse Monoclonal Cytokeratin 5/8 Antibody (SPM268) - Azide and BSA Free
NBP2-47823-0.1mg 0.1 mg

Mouse Monoclonal Cytokeratin 5/8 Antibody (SPM268) - Azide and BSA Free

Sign In for Pricing
View Details
Mouse Monoclonal Migfilin Antibody (FBLIM1/4600) [DyLight 405]
NBP3-14149V 0.1 mL

Mouse Monoclonal Migfilin Antibody (FBLIM1/4600) [DyLight 405]

Sign In for Pricing
View Details