Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MFAP4, Mouse (HEK293, His-Flag)

MFAP4 Protein participates in calcium-dependent cell adhesion or intercellular interactions and may contribute to elastic fiber assembly and maintenance. It forms homodimers and higher oligomers, interacting with FBN1, FBN2, LOX, COL1A1, and ELN in a calcium-dependent manner, promoting ELN self-assembly. MFAP4 Protein, Mouse (HEK293, His-Flag) is the recombinant mouse-derived MFAP4 protein, expressed by HEK293 , with N-His, N-Flag labeled tag.

Product Specifications

Product Name Alternative

MFAP4 Protein, Mouse (HEK293, His-Flag), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/mfap4-protein-mouse-hek293-his-flag.html

Purity

95.0

Smiles

QASGIRGDALEKSCLQQPLDCDDIYAQGYQEDGVYLIYPYGPSVPVPVFCDMTTEGGKWTVFQKRFNGSVSFFRGWSDYKLGFGRADGEYWLGLQNLHLLTLKQKYELRVDLEDFENNTAYAKYIDFSISPNAISAEEDGYTLYVAGFEDGGAGDSLSYHSGQKFSTFDRDQDLFVQNCAALSSGAFWFRSCHFANLNGFYLGGSHLSYANGINWAQWKGFYYSLKRTEMKIRRA

Molecular Formula

76293 (Gene_ID) Q9D1H9-1 (Q23-A257) (Accession)

Molecular Weight

Approximately 35-40 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD11c (HC1/1), CF647 conjugate, 0.1mg/mL
BNC470152-500 1x 500 µL

CD11c (HC1/1), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HSP60 (LK1), CF594 conjugate, 0.1mg/mL
BNC940851-100 1x 100 µL

HSP60 (LK1), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD74 (BU45), CF740 conjugate, 0.1mg/mL
BNC740189-100 1x 100 µL

CD74 (BU45), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD44 Standard (156-3C11), CF568 conjugate, 0.1mg/mL
BNC680460-500 1x 500 µL

CD44 Standard (156-3C11), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD171 / L1CAM (L1 Cell Adhesion Molecule) (UJ127), CF568 conjugate, 0.1mg/mL
BNC680679-100 1x 100 µL

CD171 / L1CAM (L1 Cell Adhesion Molecule) (UJ127), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human Lambda Light Chain (HP6054), CF488A conjugate, 0.1mg/mL
BNC880262-100 1x 100 µL

Human Lambda Light Chain (HP6054), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details