Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-5, Rabbit (HEK293, His)

The IL5 protein is a cytokine that plays a key role in regulating the growth and differentiation of eosinophils, a type of white blood cell involved in allergic reactions and asthma. Dysregulation of IL5 protein is associated with a variety of allergic and inflammatory diseases. IL-5 Protein, Rabbit (HEK293, His) is the recombinant Rabbit-derived IL-5 protein, expressed by HEK293 , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

IL-5 Protein, Rabbit (HEK293, His), Rabbit, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-5-protein-rabbit-hek293-his.html

Purity

90.00

Smiles

MATEIRMSTVVKETLTLLSTYQSLLIGNETLMIPVPVHKNHHLCIEETFRGVDTLKAQIVQGEAMDNLFQNLYLIKKYIDLQKKKCGEERRGVKHFLDYLQEFLGVINTEWTMES

Molecular Formula

100358075 (Gene_ID) G1SL79 (M20-S134) (Accession)

Molecular Weight

Approximately 15, 16-20 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Fumarylacetoacetate hydrolase (FAH) (N-term) Rabbit Polyclonal Antibody
AP51509PU-N 400 µL

Fumarylacetoacetate hydrolase (FAH) (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Amyloid Fibrils (OC) Rabbit Polyclonal Antibody
AP31731PU-N 100 µL

Amyloid Fibrils (OC) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Eprazinone Dihydrochloride
TRC-E590020-250MG 250 mg

Eprazinone Dihydrochloride

Sign In for Pricing
View Details
Frozen Tissue Sections, Lung
CS629428 5x 5 µm

Frozen Tissue Sections, Lung

Sign In for Pricing
View Details
Annexin V Recombinant Rabbit Monoclonal Antibody [JF50-11]
ET1702-62 100 µL

Annexin V Recombinant Rabbit Monoclonal Antibody [JF50-11]

Sign In for Pricing
View Details
KIAA2026 Human Gene Knockout Kit (CRISPR)
KN420620 1 Kit

KIAA2026 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details