Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-5, Rabbit (HEK293, His)

The IL5 protein is a cytokine that plays a key role in regulating the growth and differentiation of eosinophils, a type of white blood cell involved in allergic reactions and asthma. Dysregulation of IL5 protein is associated with a variety of allergic and inflammatory diseases. IL-5 Protein, Rabbit (HEK293, His) is the recombinant Rabbit-derived IL-5 protein, expressed by HEK293 , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

IL-5 Protein, Rabbit (HEK293, His), Rabbit, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-5-protein-rabbit-hek293-his.html

Purity

90.00

Smiles

MATEIRMSTVVKETLTLLSTYQSLLIGNETLMIPVPVHKNHHLCIEETFRGVDTLKAQIVQGEAMDNLFQNLYLIKKYIDLQKKKCGEERRGVKHFLDYLQEFLGVINTEWTMES

Molecular Formula

100358075 (Gene_ID) G1SL79 (M20-S134) (Accession)

Molecular Weight

Approximately 15, 16-20 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

(2-Naphthyloxy)acetyl Chloride
TRC-N378655-2.5G 2.5 g

(2-Naphthyloxy)acetyl Chloride

Sign In for Pricing
View Details
Indole-4,5,6,7-d4
TRC-I577321-2.5MG 2.5 mg

Indole-4,5,6,7-d4

Sign In for Pricing
View Details
Tissue Total RNA, Pleura
CR561104 5 µg

Tissue Total RNA, Pleura

Sign In for Pricing
View Details
MSRB2 (NM_012228) Human Recombinant Protein
TP315002M 100 µg

MSRB2 (NM_012228) Human Recombinant Protein

Sign In for Pricing
View Details
Recombinant Human Activin RIIA/ACVR2A Protein (His Tag)
PKSH031728-01 100 µg

Recombinant Human Activin RIIA/ACVR2A Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Human Activin RIIA/ACVR2A Protein (His Tag)
PKSH031728-02 1 mg

Recombinant Human Activin RIIA/ACVR2A Protein (His Tag)

Sign In for Pricing
View Details