Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-5, Rabbit (HEK293, His)

The IL5 protein is a cytokine that plays a key role in regulating the growth and differentiation of eosinophils, a type of white blood cell involved in allergic reactions and asthma. Dysregulation of IL5 protein is associated with a variety of allergic and inflammatory diseases. IL-5 Protein, Rabbit (HEK293, His) is the recombinant Rabbit-derived IL-5 protein, expressed by HEK293 , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

IL-5 Protein, Rabbit (HEK293, His), Rabbit, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-5-protein-rabbit-hek293-his.html

Purity

90.00

Smiles

MATEIRMSTVVKETLTLLSTYQSLLIGNETLMIPVPVHKNHHLCIEETFRGVDTLKAQIVQGEAMDNLFQNLYLIKKYIDLQKKKCGEERRGVKHFLDYLQEFLGVINTEWTMES

Molecular Formula

100358075 (Gene_ID) G1SL79 (M20-S134) (Accession)

Molecular Weight

Approximately 15, 16-20 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Alpha,Alpha-Diphenyl-3-pyrrolidineacetonitrile
TRC-D491890-10MG 10 mg

Alpha,Alpha-Diphenyl-3-pyrrolidineacetonitrile

Sign In for Pricing
View Details
Cyclin B2 (X29.2), CF740 conjugate, 0.1mg/mL
BNC743059-100 1x 100 µL

Cyclin B2 (X29.2), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
1-Deoxy-1-(L-aspartyl)-D-fructose Ammonium Salt
TRC-D232190-10MG 10 mg

1-Deoxy-1-(L-aspartyl)-D-fructose Ammonium Salt

Sign In for Pricing
View Details
TROY (TNFRSF19) (NM_018647) Human Over-expression Lysate
LC402704 20 µg

TROY (TNFRSF19) (NM_018647) Human Over-expression Lysate

Sign In for Pricing
View Details
mLN64 (STARD3) (NM_001165937) Human Over-expression Lysate
LY431385 100 µg

mLN64 (STARD3) (NM_001165937) Human Over-expression Lysate

Sign In for Pricing
View Details
PSMD10 Polyclonal Antibody
E-AB-90421-01 60 µL

PSMD10 Polyclonal Antibody

Sign In for Pricing
View Details