Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-5, Rabbit (HEK293, His)

The IL5 protein is a cytokine that plays a key role in regulating the growth and differentiation of eosinophils, a type of white blood cell involved in allergic reactions and asthma. Dysregulation of IL5 protein is associated with a variety of allergic and inflammatory diseases. IL-5 Protein, Rabbit (HEK293, His) is the recombinant Rabbit-derived IL-5 protein, expressed by HEK293 , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

IL-5 Protein, Rabbit (HEK293, His), Rabbit, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-5-protein-rabbit-hek293-his.html

Purity

90.00

Smiles

MATEIRMSTVVKETLTLLSTYQSLLIGNETLMIPVPVHKNHHLCIEETFRGVDTLKAQIVQGEAMDNLFQNLYLIKKYIDLQKKKCGEERRGVKHFLDYLQEFLGVINTEWTMES

Molecular Formula

100358075 (Gene_ID) G1SL79 (M20-S134) (Accession)

Molecular Weight

Approximately 15, 16-20 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CChMVd TaqMan RT-PCR Kit
TM35550 100 Reactions

CChMVd TaqMan RT-PCR Kit

Sign In for Pricing
View Details
Human PPM1M activation kit by CRISPRa
GA115166 1 Kit

Human PPM1M activation kit by CRISPRa

Sign In for Pricing
View Details
Tissue FFPE Sections, Thyroid gland
CS804207 5x 5 µm

Tissue FFPE Sections, Thyroid gland

Sign In for Pricing
View Details
BrdU (Bromodeoxyuridine) (85-2C8), 1mg/mL
BNUM0886-50 1x 50 µL

BrdU (Bromodeoxyuridine) (85-2C8), 1mg/mL

Sign In for Pricing
View Details
CACNA1H Rabbit Polyclonal Antibody
TA372157 100 µL

CACNA1H Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
N-Acetyl-L-alanine-3,3,3-d3
TRC-A168071-5MG 5 mg

N-Acetyl-L-alanine-3,3,3-d3

Sign In for Pricing
View Details