IL-5, Rabbit (HEK293, His)
The IL5 protein is a cytokine that plays a key role in regulating the growth and differentiation of eosinophils, a type of white blood cell involved in allergic reactions and asthma. Dysregulation of IL5 protein is associated with a variety of allergic and inflammatory diseases. IL-5 Protein, Rabbit (HEK293, His) is the recombinant Rabbit-derived IL-5 protein, expressed by HEK293 , with N-6*His labeled tag.
Product Specifications
Product Name Alternative
IL-5 Protein, Rabbit (HEK293, His), Rabbit, HEK293
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/il-5-protein-rabbit-hek293-his.html
Purity
90.00
Smiles
MATEIRMSTVVKETLTLLSTYQSLLIGNETLMIPVPVHKNHHLCIEETFRGVDTLKAQIVQGEAMDNLFQNLYLIKKYIDLQKKKCGEERRGVKHFLDYLQEFLGVINTEWTMES
Molecular Formula
100358075 (Gene_ID) G1SL79 (M20-S134) (Accession)
Molecular Weight
Approximately 15, 16-20 kDa, based on SDS-PAGE under reducing conditions.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Frequently Asked Questions
Explore Other Products
Browse additional items from our catalog
IgM (Immunoglobulin Mu Heavy Chain) (B-Cell Marker) (rIM260), CF740 conjugate, 0.1mg/mL
Neugrin (NGRN) (NM_016645) Human Recombinant Protein
14-3-3 zeta (YWHAZ) (NM_001135699) Human Over-expression Lysate
Divinyl Sulfone (Stabilized with Hydroquinone)
