Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-5, Rabbit (HEK293, His)

The IL5 protein is a cytokine that plays a key role in regulating the growth and differentiation of eosinophils, a type of white blood cell involved in allergic reactions and asthma. Dysregulation of IL5 protein is associated with a variety of allergic and inflammatory diseases. IL-5 Protein, Rabbit (HEK293, His) is the recombinant Rabbit-derived IL-5 protein, expressed by HEK293 , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

IL-5 Protein, Rabbit (HEK293, His), Rabbit, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-5-protein-rabbit-hek293-his.html

Purity

90.00

Smiles

MATEIRMSTVVKETLTLLSTYQSLLIGNETLMIPVPVHKNHHLCIEETFRGVDTLKAQIVQGEAMDNLFQNLYLIKKYIDLQKKKCGEERRGVKHFLDYLQEFLGVINTEWTMES

Molecular Formula

100358075 (Gene_ID) G1SL79 (M20-S134) (Accession)

Molecular Weight

Approximately 15, 16-20 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

COX6A1P2 3'UTR Lenti-reporter-Luc Vector
16697081 1.0 µg

COX6A1P2 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
Western Blot One Step Kit-GAPDH
SWBZ-K200057M 36 Tests

Western Blot One Step Kit-GAPDH

Sign In for Pricing
View Details
Rabbit Anti-Human Neu (phospho Thr686) Polyclonal Antibody
PA88911HU-01 50 µg

Rabbit Anti-Human Neu (phospho Thr686) Polyclonal Antibody

Sign In for Pricing
View Details
Rabbit Anti-Human Neu (phospho Thr686) Polyclonal Antibody
PA88911HU-02 100 µg

Rabbit Anti-Human Neu (phospho Thr686) Polyclonal Antibody

Sign In for Pricing
View Details
Rabbit Anti-Human Neu (phospho Thr686) Polyclonal Antibody
PA88911HU-03 500 µg

Rabbit Anti-Human Neu (phospho Thr686) Polyclonal Antibody

Sign In for Pricing
View Details
Rabbit Anti-Human Neu (phospho Thr686) Polyclonal Antibody
PA88911HU-04 1 mg

Rabbit Anti-Human Neu (phospho Thr686) Polyclonal Antibody

Sign In for Pricing
View Details