Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PDGF-BB, Human

PDGF-BB Protein, Human is the most active PDGF isoform, binds to PDGF receptor, promotes diverse cell types proliferation and osteogenesis, and further stimulates bone formation in fracture or defect. PDGF-BB Protein, Human improves collagenase-induced Achilles tendinopathy in rats.

Product Specifications

Product Name Alternative

PDGF-BB Protein, Human, Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/pdgf-bb-protein-human.html

Purity

98.0

Smiles

SLGSLTIAEPAMIAECKTRTEVFEISRRLIDRTNANFLVWPPCVEVQRCSGCCNNRNVQCRPTQVQLRPVQVRKIEIVRKKPIFKKATVTLEDHLACKCETVAAARPVT

Molecular Formula

5155 (Gene_ID) P01127-1 (S82-T190) (Accession)

Molecular Weight

Approximately 14 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Sun H, et al. Recombinant human platelet-derived growth factor-BB versus autologous bone graft in foot and ankle fusion: A systematic review and meta-analysis. Foot Ankle Surg. 2017 Mar;23 (1) :32-39.|[2]Solchaga LA, et al. Comparison of the effect of intra-tendon applications of recombinant human platelet-derived growth factor-BB, platelet-rich plasma, steroids in a rat achilles tendon collagenase model. J Orthop Res. 2014 Jan;32 (1) :145-50.|[3]Chen L, et al. Inhibition of PDGF-BB reduces alkali-induced corneal neovascularization in mice. Mol Med Rep. 2021 Apr;23 (4) :238.|[4]Park SA, et al. PDGF-BB does not accelerate healing in diabetic mice with splinted skin wounds. PLoS One. 2014 Aug 14;9 (8) :e104447.|[5]Chung R, et al. Potential roles of growth factor PDGF-BB in the bony repair of injured growth plate. Bone. 2009 May;44 (5) :878-85.|[6]Au P, et al. Paradoxical effects of PDGF-BB overexpression in endothelial cells on engineered blood vessels in vivo. Am J Pathol. 2009 Jul;175 (1) :294-302.|[7]Cao H, et al. PDGF-BB prevents destructive repair and promotes reparative osteogenesis of steroid-associated osteonecrosis of the femoral head in rabbits. Bone. 2023 Feb;167:116645.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal CDC42EP2 Antibody [DyLight 350]
NBP3-06534UV 0.1 mL

Rabbit Polyclonal CDC42EP2 Antibody [DyLight 350]

Sign In for Pricing
View Details
Arylsulfatase E HDR Plasmid (h)
sc-410692-HDR 20 µg

Arylsulfatase E HDR Plasmid (h)

Sign In for Pricing
View Details
Protocadherin β-7 (PCDHB7) Human ELISA Kit
G4751 96 Tests

Protocadherin β-7 (PCDHB7) Human ELISA Kit

Sign In for Pricing
View Details
SK1 CRISPR/Cas9 KO Plasmid (m)
sc-429968 20 µg

SK1 CRISPR/Cas9 KO Plasmid (m)

Sign In for Pricing
View Details
ELISA Kit For Transmembrane protein FAM155A
E16276b 96 Tests

ELISA Kit For Transmembrane protein FAM155A

Sign In for Pricing
View Details
ATG12 (ATG12 autophagy Related 12 Homolog (S. cerevisiae), APG12, APG12L, FBR93, HAPG12) (AP)
MBS6164780-01 0.1 mL

ATG12 (ATG12 autophagy Related 12 Homolog (S. cerevisiae), APG12, APG12L, FBR93, HAPG12) (AP)

Sign In for Pricing
View Details