What is the catalog number for IL8/CXCL8 Antibody?

The catalog number for IL8/CXCL8 Antibody is KC-403.

What sizes are available for IL8/CXCL8 Antibody?

IL8/CXCL8 Antibody is available in the following size(s): 50 μL, 100 µL, 1 mL.

How many pack sizes does IL8/CXCL8 Antibody come in?

IL8/CXCL8 Antibody is available in 3 different pack sizes.

Is IL8/CXCL8 Antibody in stock?

IL8/CXCL8 Antibody is currently made to order / not held in immediate stock. Contact us for lead time.

How many freeze-thaw cycles can this product tolerate?

We recommend aliquoting the product upon receipt to avoid repeated freeze-thaw cycles, which can reduce activity and stability. This is your responsibility once the product has been delivered.

Is antigen retrieval required for IHC with this antibody?

Recommended antigen retrieval methods, where applicable, are listed on the datasheet under the IHC protocol section.

What temperature does this product ship at?

Shipping temperature is chosen based on the product’s stability needs, ranging from ambient to dry ice, and is indicated on the product page. Any related shipping fee is shown clearly in your quotation.

IL8/CXCL8 Antibody

Product Specifications

Product Name Alternative

Interleukin-8, IL-8, C-X-C motif chemokine 8, Chemokine, C-X-C motif) ligand 8, Emoctakin, Granulocyte chemotactic protein 1, GCP-1, Monocyte-derived neutrophil chemotactic factor, MDNCF, Monocyte-derived neutrophil-activating peptide, MONAP, Neutrophil-activating protein 1, NAP-1, Protein 3-10C, T-cell chemotactic factor) [Cleaved into: MDNCF-a, GCP/IL-8 protein IV, IL8/NAP1 form I, Interleukin-8, (Ala-IL-8) 77, GCP/IL-8 protein II, IL-8 (1-77), IL8/NAP1 form II, MDNCF-b, IL-8 (5-77, IL-8 (6-77, (Ser-IL-8) 72, GCP/IL-8 protein I, IL8/NAP1 form III, Lymphocyte-derived neutrophil-activating factor, LYNAP, MDNCF-c, Neutrophil-activating factor, NAF, IL-8 (7-77, GCP/IL-8 protein V, IL8/NAP1 form IV, IL-8 (8-77, GCP/IL-8 protein VI, IL8/NAP1 form V, IL-8 (9-77, GCP/IL-8 protein III, IL8/NAP1 form VI]

Gene Name

CXCL8

Gene ID

3576

UniProt

P10145

Antigen Species

Human

Reactivity

Human

Cross Reactivity

KT214 does not cross-react with human IL1B, IL2, IL4, IL5, IL6, IL7, IL9, IL10, IL11, IL12, IL13, CSF2, IFNA, IFNG, CCL2, KITLG and TNF

Immunogen

Recombinant human CXCL8

Target

PP-530

Partner Proteins

Interleukin-8; IL-8; C-X-C motif chemokine 8; Chemokine; C-X-C motif) ligand 8; Emoctakin; Granulocyte chemotactic protein 1; GCP-1; Monocyte-derived neutrophil chemotactic factor; MDNCF; Monocyte-derived neutrophil-activating peptide; MONAP; Neutrophil-activating protein 1; NAP-1; Protein 3-10C; T-cell chemotactic factor) [Cleaved into: MDNCF-a; GCP/IL-8 protein IV; IL8/NAP1 form I; Interleukin-8; (Ala-IL-8) 77; GCP/IL-8 protein II; IL-8 (1-77) ; IL8/NAP1 form II; MDNCF-b; IL-8 (5-77; IL-8 (6-77; (Ser-IL-8) 72; GCP/IL-8 protein I; IL8/NAP1 form III; Lymphocyte-derived neutrophil-activating factor; LYNAP; MDNCF-c; Neutrophil-activating factor; NAF; IL-8 (7-77; GCP/IL-8 protein V; IL8/NAP1 form IV; IL-8 (8-77; GCP/IL-8 protein VI; IL8/NAP1 form V; IL-8 (9-77; GCP/IL-8 protein III; IL8/NAP1 form VI]

Clone

KT214

Conjugation

Unconjugated

Applications

Validation

Homology

Highest antigen sequence identity to the following orthologs: Mouse - 53%, Rat - 52%, Pig - 76%, Cynomolgus monkey - 96%

Purity

≥85%

Cores

ELRCQCIKTYSKPFHPKFIKELRVIESGPHCANTEIIVKLSDGRELCLDPKENWVQRVVE

Storage Temperature

Avoid repeated freeze-thaw cycles. Upon receipt, * 1 month when stored at 2 to 8 °C * 12 months when aliquoted and stored at -20 °C or lower

Identity Mouse

53%

Recombinant Antibody

Not recombinant

WB Dilution

1:1000

Formulation

Phosphate-buffered saline (PBS) with 50% glycerol, 0.5% BSA and 0.09% sodium azide

Antibody Type

Monoclonal

Gene Name Synonym

IL8

Target Alternative Name

CXCL8

Panel Description

Cytokines, Ferroptosis

Host or Source

Mouse

Protein Name

C-X-C motif chemokine ligand 8

WB Description

Succeed

IHC description

Fail (Tonsil)

Shipping Temperature

Shipped at ambient temperature or with ice packs.

Isotype

IgG1

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RC-14994-01 50 μL

Recombinant Interferon beta Antibody

View Details

RC-14994-02 100 µL

Recombinant Interferon beta Antibody

View Details

RC-14994-03 1 mL

Recombinant Interferon beta Antibody

View Details

BNC471176-100 1x 100 µL

EMI1 (EMI1/1176), CF647 conjugate, 0.1mg/mL

View Details

AP13803PU-N 400 µL

PANK1 (Center) Rabbit Polyclonal Antibody

View Details

BNUM2421-50 1x 50 µL

BOB.1 (B-Cell Marker) (BOB1/2421), 1mg/mL

View Details