Question 1

What is the catalog number for P-Hydroxybenzoic acid?

Accepted Answer

The catalog number for P-Hydroxybenzoic acid is AB0001.

Question 2

What sizes are available for P-Hydroxybenzoic acid?

Accepted Answer

P-Hydroxybenzoic acid is available in the following size(s): 20 mg.

Question 3

Is P-Hydroxybenzoic acid in stock?

Accepted Answer

P-Hydroxybenzoic acid is currently made to order / not held in immediate stock. Contact us for lead time.

Question 4

What is the immunogen used to generate this antibody?

Accepted Answer

Immunogen or antigen details used to raise this antibody are listed on the product datasheet under immunogen information.

Question 5

What is the recommended positive control for this assay?

Accepted Answer

A recommended positive control, where one is specified by the manufacturer, is listed on the datasheet or in the assay protocol.

Question 6

How should this product be stored?

Accepted Answer

Storage conditions depend on the specific reagent and are listed on the product datasheet, with most antibodies and proteins requiring -20°C unless stated otherwise. It is your responsibility to store the product correctly immediately upon receipt; damage from improper storage after delivery is not eligible for replacement.

P-Hydroxybenzoic acid

Product Specifications

CAS Number

Purity

Molecular Formula

Molecular Weight

Frequently Asked Questions

Explore Other Products

ZNF394 (Zinc Finger Protein 394, FLJ12298, ZKSCAN14) (Biotin)

ZNF394 (Zinc Finger Protein 394, FLJ12298, ZKSCAN14) (Biotin)

VSGLNPSLWSIFGLQFILLWLVSGSRHYLW TFA

VSGLNPSLWSIFGLQFILLWLVSGSRHYLW TFA

Thalidomide 5'-amine-alkylC6-amine

AKR1B10 Rabbit pAb, IRDye 800CW conjugated