Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Amyloid Beta Peptide 1-40 Monomers

Human Synthetic Amyloid Beta Peptide 1-40 Monomers

Product Specifications

Background

Amyloid Beta 1-40 peptide (Aβ40) is a major isoform implicated in Alzheimer’s disease, contributing to plaque formation and neurotoxicity despite being less aggregation-prone than Aβ42. Aβ40’s interaction with neural membranes and metal ions accelerates oligomerization and oxidative stress, disrupting neuronal function. Genetic factors like PLXNB1 influence glial responses and plaque morphology, modulating neuroinflammation and disease progression. Our Amyloid Beta Peptide 1-40 Monomers are produced synthetically and presents as a monomeric band at the expected molecular weight (MW) on SDS-PAGE via Coomassie Stain and Western Blot.

Product Name Alternative

Aβ 1-40, AB40, Amyloid beta 1-40, Beta-amyloid peptide (1-40), Amyloid-beta A4 protein, Amyloid precursor protein (APP), Alzheimer disease amyloid protein, Cerebral vascular amyloid peptide (CVAP), Protease nexin-II (PN-II), PreA4, Peptidase nexin-II, APP40, BAPP40, BetaAPP40

UNSPSC

12352202

UN Code

Non-hazardous

Hazard Statement

Non-hazardous

Gene ID

351

Swiss Prot

P05067

Expression System

Synthetic

Conjugation

No Tag

Nature

Synthetic

Applications

WB | SDS-PAGE

Field of Research

Neuroscience | Neurodegeneration | Alzheimer's Disease | Amyloid

Limit Of Detection

Certified > 98% pure using mass spec and HPLC

Concentration

1 mg/mL

Purity

> 98%

Buffer

PB pH7.4, 10mM NaCl

Molecular Weight

4.5 kDa

Precautions

Not for use in humans. Not for use in diagnostics or therapeutics. For research use only.

Shipping Conditions

Dry Ice. Shipping note: Product will be shipped separately from other products purchased in the same order.

Storage Conditions

-80ºC

Protein Length

40 amino acids

Background Reference 01

1. Ghosh, P., Narang, K., & Iyer, P. K. (2024) . Role of Amyloid Beta in Neurodegeneration and Therapeutic Strategies for Neuroprotection. Methods in molecular biology (Clifton, N.J.), 2761, 337–354. https://doi.org/10.1007/978-1-0716-3662-6_25 2. Huang, Y., et al. (2024) . Regulation of cell distancing in peri-plaque glial nets by Plexin-B1 affects glial activation and amyloid compaction in Alzheimer’s disease. Nature Neuroscience, 27, 1489–1504. https://doi.org/10.1038/s41593-024-01664-w 3. Mirdha L. (2024) . Aggregation Behavior of Amyloid Beta Peptide Depends Upon the Membrane Lipid Composition. The Journal of membrane biology, 257 (3-4), 151–164. https://doi.org/10.1007/s00232-024-00314-3

AA Sequence

DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV

Immunogen Species

Human

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ep-CAM / CD326 (VU-1D9), CF555 conjugate, 0.1mg/mL
BNC550017-100 1x 100 µL

Ep-CAM / CD326 (VU-1D9), CF555 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD8 (C8/1035), CF405S conjugate, 0.1mg/mL
BNC041035-500 1x 500 µL

CD8 (C8/1035), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD43 (84-3C1), CF640R conjugate, 0.1mg/mL
BNC400342-500 1x 500 µL

CD43 (84-3C1), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
GLUT-1 (Tumor Progression and Mesothelioma Marker) (GLUT1/2475), CF647 conjugate, 0.1mg/mL
BNC472475-100 1x 100 µL

GLUT-1 (Tumor Progression and Mesothelioma Marker) (GLUT1/2475), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TLE1 (Synovial Sarcoma Marker) (TLE1/2062), CF405S conjugate, 0.1mg/mL
BNC042062-500 1x 500 µL

TLE1 (Synovial Sarcoma Marker) (TLE1/2062), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MUC1 / CA15-3 / EMA / CD227 (Epithelial Marker) (MUC1/1887R), CF594 conjugate, 0.1mg/mL
BNC941887-500 1x 500 µL

MUC1 / CA15-3 / EMA / CD227 (Epithelial Marker) (MUC1/1887R), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details