Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Tau (K18) Wild-Type Pre-formed Fibrils

Human Recombinant Tau (K18) Wild-Type PFFs

Product Specifications

Background

Tauopathies are a class of neurodegenerative diseases characterized by the pathological aggregation of tau protein into insoluble fibrils that disrupt neuronal function. The K18 fragment, which includes the four microtubule-binding repeat domains of tau, is frequently used in experimental models due to its propensity to form fibrillar aggregates. Kumar & Udgaonkar (2022) observed that tau K18 wildtype fibrils exhibit distinct structural features compared to mutant forms, with the wildtype fibrils catalyzing aggregation of monomeric tau more efficiently. StressMarq’s Human Recombinant Tau (K18) Wild-Type Pre-Formed Fibrils have been demonstrated to seed monomers in an in-vitro ThT seeding assay.

Product Name Alternative

Tau, Microtubule-associated Tau, Microtubule-associated protein Tau, MAPT, MAP, Tau-441, Tau-412, Tau-381, Tau-352, Paired Helical Filament-Tau, PHF-Tau, Neurofibrillary Tangle Tau, G Beta/Gamma Subunit-Interacting Factor 1, Isoform 4, Tubulin-associated unit

UNSPSC

12352202

UN Code

Non-hazardous

Hazard Statement

Non-hazardous

Swiss Prot

P10636

Expression System

E. coli

Conjugation

No Tag

Nature

Recombinant

Applications

WB | SDS-PAGE | In vivo assay | In vitro assay

Field of Research

Neuroscience | Neurodegeneration | Alzheimer's Disease | Tangles & Tau

Purification

Ion-exchange Purified

Limit Of Detection

Certified > 95% pure via SDS-PAGE and A260/A280 ratio

Concentration

2 mg/ml

Purity

> 95%

Buffer

10 mM HEPES pH 7.4, 100 mM NaCl

Molecular Weight

15.18 kDa

Precautions

Not for use in humans. Not for use in diagnostics or therapeutics. For research use only.

Shipping Conditions

Dry Ice. Shipping note: Product will be shipped separately from other products purchased in the same order.

Storage Conditions

-80ºC

Notes

Product is wildtype equivalent of Catalog No. SPR-330. Corresponding monomer is SPR-524.

Protein Length

141 amino acids

Background Reference 01

Boyarko, B., & Hook, V. (2021) . Human tau isoforms and proteolysis for production of toxic tau fragments in neurodegeneration. Frontiers in Neuroscience, 15, 702788. https://doi.org/10.3389/fnins.2021.702788 Kumar, H., & Udgaonkar, J. B. (2022) . Elongation of fibrils formed by a tau fragment is inhibited by a transient dimeric intermediate. The Journal of Physical Chemistry B, 126 (18), 3385–3397. https://doi.org/10.1021/acs.jpcb.1c10752 Zeng, Y., Yang, J., Zhang, B., Gao, M., Su, Z., & Huang, Y. (2020) . The structure and phase of tau: From monomer to amyloid filament. Cellular and Molecular Life Sciences, 78, 1873–1886. https://doi.org/10.1007/s00018-020-03681-x Zhang, X., Wang, J., Zhang, Z., & Ye, K. (2024) . Tau in neurodegenerative diseases: Molecular mechanisms, biomarkers, and therapeutic strategies. Translational Neurodegeneration, 13 (40) . https://doi.org/10.1186/s40035-024-00429-6

AA Sequence

MSRLQTAPVPMPDLKNVKSKIGSTENLKHQPGGGKVQIINKKLDLSNVQSKCGSKDNIKHVPGGGSVQIVYKPVDLSKVTSKCGSLGNIHHKPGGGQVEVKSEKLKDFDRVQSKIGSLDNITHVPGGGNKKIETHKLTFRE

Immunogen Species

Human

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Lentiviral mouse Lrrc28 shRNA (UAS) - Lentiviral mouse Lrrc28 shRNA (UAS, iRFP) plasmid
GTR15237424 1 Vial

Lentiviral mouse Lrrc28 shRNA (UAS) - Lentiviral mouse Lrrc28 shRNA (UAS, iRFP) plasmid

Ask
View Details
RGD1560010 Rat siRNA Oligo Duplex (Locus ID 310537)
SR514310 1 Kit

RGD1560010 Rat siRNA Oligo Duplex (Locus ID 310537)

Ask
View Details
Porcine deoxyuridinetriphate (DUTP) ELISA Kit
MBS265879-01 48 Well

Porcine deoxyuridinetriphate (DUTP) ELISA Kit

Ask
View Details
Porcine deoxyuridinetriphate (DUTP) ELISA Kit
MBS265879-02 96 Well

Porcine deoxyuridinetriphate (DUTP) ELISA Kit

Ask
View Details
Porcine deoxyuridinetriphate (DUTP) ELISA Kit
MBS265879-03 5x 96 Well

Porcine deoxyuridinetriphate (DUTP) ELISA Kit

Ask
View Details
Porcine deoxyuridinetriphate (DUTP) ELISA Kit
MBS265879-04 10x 96 Well

Porcine deoxyuridinetriphate (DUTP) ELISA Kit

Ask
View Details