Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Tau (K18) Wild-Type Monomers

Human Recombinant Tau (K18) Wild-Type Monomers

Product Specifications

Background

Tauopathies are a class of neurodegenerative diseases characterized by the pathological aggregation of tau protein into insoluble fibrils that disrupt neuronal function. The K18 fragment, which includes the four microtubule-binding repeat domains of tau, is frequently used in experimental models due to its propensity to form fibrillar aggregates. This fragment retains key aggregation-prone hexapeptide motifs that drive β-sheet formation and fibrillization. StressMarq’s Human Recombinant Tau (K18) Wild-Type Monomers have been demonstrated to form fibrils in the presence of heparin or when seeded with fibrils.

Product Name Alternative

Tau, Microtubule-associated Tau, Microtubule-associated protein Tau, MAPT, MAP, Tau-441, Tau-412, Tau-381, Tau-352, Paired Helical Filament-Tau, PHF-Tau, Neurofibrillary Tangle Tau, G Beta/Gamma Subunit-Interacting Factor 1, Isoform 4, Tubulin-associated unit

UNSPSC

12352202

UN Code

Non-hazardous

Hazard Statement

Non-hazardous

Swiss Prot

P10636

Expression System

E. coli

Conjugation

No Tag

Nature

Recombinant

Applications

WB | SDS-PAGE | In vivo assay | In vitro assay

Field of Research

Neuroscience | Neurodegeneration | Alzheimer's Disease | Tangles & Tau

Purification

Ion-exchange Purified

Limit Of Detection

Certified > 95% pure via SDS-PAGE and A260/A280 ratio

Concentration

2 mg/ml

Purity

> 95%

Buffer

10 mM HEPES pH 7.4, 100 mM NaCl

Molecular Weight

15.18 kDa

Precautions

Not for use in humans. Not for use in diagnostics or therapeutics. For research use only.

Shipping Conditions

Dry Ice. Shipping note: Product will be shipped separately from other products purchased in the same order.

Storage Conditions

-80ºC

Notes

Product is wildtype equivalent of SPR-328. Corresponding fibril is SPR-525.

Protein Length

141 amino acids

Background Reference 01

Boyarko, B., & Hook, V. (2021) . Human tau isoforms and proteolysis for production of toxic tau fragments in neurodegeneration. Frontiers in Neuroscience, 15, 702788. https://doi.org/10.3389/fnins.2021.702788 Zeng, Y., Yang, J., Zhang, B., Gao, M., Su, Z., & Huang, Y. (2020) . The structure and phase of tau: From monomer to amyloid filament. Cellular and Molecular Life Sciences, 78, 1873–1886. https://doi.org/10.1007/s00018-020-03681-x Zhang, X., Wang, J., Zhang, Z., & Ye, K. (2024) . Tau in neurodegenerative diseases: Molecular mechanisms, biomarkers, and therapeutic strategies. Translational Neurodegeneration, 13 (40) . https://doi.org/10.1186/s40035-024-00429-6

AA Sequence

MSRLQTAPVPMPDLKNVKSKIGSTENLKHQPGGGKVQIINKKLDLSNVQSKCGSKDNIKHVPGGGSVQIVYKPVDLSKVTSKCGSLGNIHHKPGGGQVEVKSEKLKDFDRVQSKIGSLDNITHVPGGGNKKIETHKLTFRE

Immunogen Species

Human

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Recombinant Human TNF Receptor Associated Factor 6 (TRAF6)
RPU44058-01 50 µg

Recombinant Human TNF Receptor Associated Factor 6 (TRAF6)

Ask
View Details
Recombinant Human TNF Receptor Associated Factor 6 (TRAF6)
RPU44058-02 100 µg

Recombinant Human TNF Receptor Associated Factor 6 (TRAF6)

Ask
View Details
Recombinant Human TNF Receptor Associated Factor 6 (TRAF6)
RPU44058-03 1 mg

Recombinant Human TNF Receptor Associated Factor 6 (TRAF6)

Ask
View Details
EGFR, NT (Epidermal Growth Factor Receptor, Receptor Tyrosine-protein Kinase ErbB-1, Proto-oncogene c-ErbB-1, ERBB1) (MaxLight 490) discontinued
E3375-11V-ML490 100 µL

EGFR, NT (Epidermal Growth Factor Receptor, Receptor Tyrosine-protein Kinase ErbB-1, Proto-oncogene c-ErbB-1, ERBB1) (MaxLight 490) discontinued

Ask
View Details
Maximum Recovery Diluent (MRD)
KM0040-500G 500 g

Maximum Recovery Diluent (MRD)

Ask
View Details
WSB2 antibody
70R-21331 50 ul

WSB2 antibody

Ask
View Details