Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Animal-Free HMGB2/HMG-2, Human (His)

The multifunctional HMGB2/HMG-2 protein exhibits multiple cellular functions and may function in a redox-sensitive manner. In the nucleus, it acts as a chromatin-associated non-histone protein that is essential for transcription, chromatin remodeling and V (D) J reorganization. Animal-Free HMGB2/HMG-2 Protein, Human (His) is the recombinant human-derived animal-FreeHMGB2/HMG-2 protein, expressed by E. coli , with C-His labeled tag. This product is for cell culture use only.

Product Specifications

Product Name Alternative

Animal-Free HMGB2/HMG-2 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/animal-free-hmgb2-hmg-2-protein-human-his.html

Purity

95.0

Smiles

MGKGDPNKPRGKMSSYAFFVQTCREEHKKKHPDSSVNFAEFSKKCSERWKTMSAKEKSKFEDMAKSDKARYDREMKNYVPPKGDKKGKKKDPNAPKRPPSAFFLFCSEHRPKIKSEHPGLSIGDTAKKLGEMWSEQSAKDKQPYEQKAAKLKEKYEKDIAAYRAKGKSEAGKKGPGRPTGSKKKNEPEDEEEEEEEEDEDEEEEDEDEE

Molecular Formula

3148 (Gene_ID) P26583 (M1-E209) (Accession)

Molecular Weight

Approximately 24.84 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CST9 (NM_001008693) Human Over-expression Lysate
LY423346 100 µg

CST9 (NM_001008693) Human Over-expression Lysate

Sign In for Pricing
View Details
Tissue FFPE Sections, Lung
CS706005 5x 5 µm

Tissue FFPE Sections, Lung

Sign In for Pricing
View Details
Blood Bank Refrigerated Centrifuge BBRC-205
BBRC-205 1 Unit

Blood Bank Refrigerated Centrifuge BBRC-205

Sign In for Pricing
View Details
Plp2 (BC092095) Mouse Tagged ORF Clone
MG201101 10 µg

Plp2 (BC092095) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
RFP Goat Polyclonal Antibody
AB1140-100 300 µg

RFP Goat Polyclonal Antibody

Sign In for Pricing
View Details
Vimentin (Mesenchymal Cell Marker) (V9), CF640R conjugate, 0.1mg/mL
BNC402775-100 1x 100 µL

Vimentin (Mesenchymal Cell Marker) (V9), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details