Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RCN3, Mouse (HEK293, His)

RCN3 Protein, a probable molecular chaperone, ensures pulmonary surfactant homeostasis by aiding in proper biosynthesis and transport of SP-A, SP-D, and ABCA3. It exhibits anti-fibrotic activity by negatively regulating type I and type III collagen secretion. RCN3 transiently associates with immature PCSK6, suggesting its role in PCSK6 maturation and secretion. RCN3 Protein, Mouse (HEK293, His) is the recombinant mouse-derived RCN3 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

RCN3 Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/rcn3-protein-mouse-hek293-his.html

Purity

98.0

Smiles

KPSPDAGPHGQDRVHHGTPLSEAPHDDAHGNFQYDHEAFLGRDVAKEFDKLSPEESQARLGRIVDRMDLAGDSDGWVSLAELRAWIAHTQQRHIRDSVSAAWHTYDTDRDGRVGWEELRNATYGHYEPGEEFHDVEDAETYKKMLARDERRFRVADQDGDSMATREELTAFLHPEEFPHMRDIVVAETLEDLDKNKDGYVQVEEYIADLYSEEPGEEEPAWVQTERQQFREFRDLNKDGRLDGSEVGYWVLPPSQDQPLVEANHLLHESDTDKDGRLSKAEILSNWNMFVGSQATNYGEDLTRHHDEL

Molecular Formula

52377 (Gene_ID) Q8BH97 (K21-L328) (Accession)

Molecular Weight

Approximately 48 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Monoclonal Uteroglobin/SCGB1A1 Antibody (016) [mFluor Violet 450 SE]
NBP2-90515MFV450 0.1 mL

Rabbit Monoclonal Uteroglobin/SCGB1A1 Antibody (016) [mFluor Violet 450 SE]

Sign In for Pricing
View Details
Rat Anti-mouse CD45R/APC-Cy7 antibody
SLM-30307A-APC-Cy7-01 25 Tests

Rat Anti-mouse CD45R/APC-Cy7 antibody

Sign In for Pricing
View Details
Rat Anti-mouse CD45R/APC-Cy7 antibody
SLM-30307A-APC-Cy7-02 50 Tests

Rat Anti-mouse CD45R/APC-Cy7 antibody

Sign In for Pricing
View Details
Rat Anti-mouse CD45R/APC-Cy7 antibody
SLM-30307A-APC-Cy7-03 100 Tests - Cy7

Rat Anti-mouse CD45R/APC-Cy7 antibody

Sign In for Pricing
View Details
TSN, ID (TSN, Translin, Component 3 of promoter of RISC) (MaxLight 405)
MBS6359523-01 0.1 mL

TSN, ID (TSN, Translin, Component 3 of promoter of RISC) (MaxLight 405)

Sign In for Pricing
View Details
TSN, ID (TSN, Translin, Component 3 of promoter of RISC) (MaxLight 405)
MBS6359523-02 5x 0.1 mL

TSN, ID (TSN, Translin, Component 3 of promoter of RISC) (MaxLight 405)

Sign In for Pricing
View Details