Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RCN3, Mouse (HEK293, His)

RCN3 Protein, a probable molecular chaperone, ensures pulmonary surfactant homeostasis by aiding in proper biosynthesis and transport of SP-A, SP-D, and ABCA3. It exhibits anti-fibrotic activity by negatively regulating type I and type III collagen secretion. RCN3 transiently associates with immature PCSK6, suggesting its role in PCSK6 maturation and secretion. RCN3 Protein, Mouse (HEK293, His) is the recombinant mouse-derived RCN3 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

RCN3 Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/rcn3-protein-mouse-hek293-his.html

Purity

98.0

Smiles

KPSPDAGPHGQDRVHHGTPLSEAPHDDAHGNFQYDHEAFLGRDVAKEFDKLSPEESQARLGRIVDRMDLAGDSDGWVSLAELRAWIAHTQQRHIRDSVSAAWHTYDTDRDGRVGWEELRNATYGHYEPGEEFHDVEDAETYKKMLARDERRFRVADQDGDSMATREELTAFLHPEEFPHMRDIVVAETLEDLDKNKDGYVQVEEYIADLYSEEPGEEEPAWVQTERQQFREFRDLNKDGRLDGSEVGYWVLPPSQDQPLVEANHLLHESDTDKDGRLSKAEILSNWNMFVGSQATNYGEDLTRHHDEL

Molecular Formula

52377 (Gene_ID) Q8BH97 (K21-L328) (Accession)

Molecular Weight

Approximately 48 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human CTH Matched Antibody Pair Set [IV11498/Poly]
Z01LS-1122-LS834 5 Plates

Human CTH Matched Antibody Pair Set [IV11498/Poly]

Sign In for Pricing
View Details
ASTN2 Antibody, Biotin conjugated
MBS7047724-01 0.05 mg

ASTN2 Antibody, Biotin conjugated

Sign In for Pricing
View Details
ASTN2 Antibody, Biotin conjugated
MBS7047724-02 0.1 mg

ASTN2 Antibody, Biotin conjugated

Sign In for Pricing
View Details
ASTN2 Antibody, Biotin conjugated
MBS7047724-03 5x 0.1 mg

ASTN2 Antibody, Biotin conjugated

Sign In for Pricing
View Details
Cysltr2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)
K3822407 1.0 µg DNA

Cysltr2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details
Recombinant Human ABCB10 Protein, His (Fc)-Avi-tagged
ABCB10-2401H 50 µg

Recombinant Human ABCB10 Protein, His (Fc)-Avi-tagged

Sign In for Pricing
View Details