Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RCN3, Mouse (HEK293, His)

RCN3 Protein, a probable molecular chaperone, ensures pulmonary surfactant homeostasis by aiding in proper biosynthesis and transport of SP-A, SP-D, and ABCA3. It exhibits anti-fibrotic activity by negatively regulating type I and type III collagen secretion. RCN3 transiently associates with immature PCSK6, suggesting its role in PCSK6 maturation and secretion. RCN3 Protein, Mouse (HEK293, His) is the recombinant mouse-derived RCN3 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

RCN3 Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/rcn3-protein-mouse-hek293-his.html

Purity

98.0

Smiles

KPSPDAGPHGQDRVHHGTPLSEAPHDDAHGNFQYDHEAFLGRDVAKEFDKLSPEESQARLGRIVDRMDLAGDSDGWVSLAELRAWIAHTQQRHIRDSVSAAWHTYDTDRDGRVGWEELRNATYGHYEPGEEFHDVEDAETYKKMLARDERRFRVADQDGDSMATREELTAFLHPEEFPHMRDIVVAETLEDLDKNKDGYVQVEEYIADLYSEEPGEEEPAWVQTERQQFREFRDLNKDGRLDGSEVGYWVLPPSQDQPLVEANHLLHESDTDKDGRLSKAEILSNWNMFVGSQATNYGEDLTRHHDEL

Molecular Formula

52377 (Gene_ID) Q8BH97 (K21-L328) (Accession)

Molecular Weight

Approximately 48 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

TRMT12 Protein Vector (Human) (pPM-C-His)
PV044032 500 ng

TRMT12 Protein Vector (Human) (pPM-C-His)

Sign In for Pricing
View Details
Tissue, Total Protein, Human Tumor, Skin
MBS657502-01 1 mg

Tissue, Total Protein, Human Tumor, Skin

Sign In for Pricing
View Details
Tissue, Total Protein, Human Tumor, Skin
MBS657502-02 5x 1 mg

Tissue, Total Protein, Human Tumor, Skin

Sign In for Pricing
View Details
Ornithine Carbamoyltransferase (OTC) Mouse Monoclonal Antibody [Clone ID: OTI2C12]
TA802395 100 µL

Ornithine Carbamoyltransferase (OTC) Mouse Monoclonal Antibody [Clone ID: OTI2C12]

Sign In for Pricing
View Details
URGCP Protein Vector (Mouse) (pPB-N-His)
PV244355 500 ng

URGCP Protein Vector (Mouse) (pPB-N-His)

Sign In for Pricing
View Details
CXCL13 (C-X-C Motif Chemokine 13, Angie, B cell-attracting Chemokine 1, BCA-1, B Lymphocyte Chemoattractant, CXC Chemokine BLC, Small-inducible Cytokine B13, BCA1, BLC, SCYB13) (PE)
125503-PE 100 µL

CXCL13 (C-X-C Motif Chemokine 13, Angie, B cell-attracting Chemokine 1, BCA-1, B Lymphocyte Chemoattractant, CXC Chemokine BLC, Small-inducible Cytokine B13, BCA1, BLC, SCYB13) (PE)

Sign In for Pricing
View Details