Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RCN3, Mouse (HEK293, His)

RCN3 Protein, a probable molecular chaperone, ensures pulmonary surfactant homeostasis by aiding in proper biosynthesis and transport of SP-A, SP-D, and ABCA3. It exhibits anti-fibrotic activity by negatively regulating type I and type III collagen secretion. RCN3 transiently associates with immature PCSK6, suggesting its role in PCSK6 maturation and secretion. RCN3 Protein, Mouse (HEK293, His) is the recombinant mouse-derived RCN3 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

RCN3 Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/rcn3-protein-mouse-hek293-his.html

Purity

98.0

Smiles

KPSPDAGPHGQDRVHHGTPLSEAPHDDAHGNFQYDHEAFLGRDVAKEFDKLSPEESQARLGRIVDRMDLAGDSDGWVSLAELRAWIAHTQQRHIRDSVSAAWHTYDTDRDGRVGWEELRNATYGHYEPGEEFHDVEDAETYKKMLARDERRFRVADQDGDSMATREELTAFLHPEEFPHMRDIVVAETLEDLDKNKDGYVQVEEYIADLYSEEPGEEEPAWVQTERQQFREFRDLNKDGRLDGSEVGYWVLPPSQDQPLVEANHLLHESDTDKDGRLSKAEILSNWNMFVGSQATNYGEDLTRHHDEL

Molecular Formula

52377 (Gene_ID) Q8BH97 (K21-L328) (Accession)

Molecular Weight

Approximately 48 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

MRPL16 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)
K1327908 1.0 µg DNA

MRPL16 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
Human CD81 (CD81 antigen) QuickTest ELISA Kit
QT-EH7221 96 Tests

Human CD81 (CD81 antigen) QuickTest ELISA Kit

Sign In for Pricing
View Details
Anti-free Prostate Specific Antigen (fPSA) Monoclonal Antibody This antibody is paired with TBS10165, TBS10166, and TBS10168
TBS10167-0.2MG 0.2 mg

Anti-free Prostate Specific Antigen (fPSA) Monoclonal Antibody This antibody is paired with TBS10165, TBS10166, and TBS10168

Sign In for Pricing
View Details
Rabbit Polyclonal NDUFV2 Antibody [Alexa Fluor 750]
NBP2-99225AF750 0.1 mL

Rabbit Polyclonal NDUFV2 Antibody [Alexa Fluor 750]

Sign In for Pricing
View Details
CPN1 Protein Vector (Human) (pPM-C-HA)
PV010499 500 ng

CPN1 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
CYP2C9 Antibody / Cytochrome P450 2C9
V5682SAF-100UG 100 µg

CYP2C9 Antibody / Cytochrome P450 2C9

Sign In for Pricing
View Details