Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RCN3, Mouse (HEK293, His)

RCN3 Protein, a probable molecular chaperone, ensures pulmonary surfactant homeostasis by aiding in proper biosynthesis and transport of SP-A, SP-D, and ABCA3. It exhibits anti-fibrotic activity by negatively regulating type I and type III collagen secretion. RCN3 transiently associates with immature PCSK6, suggesting its role in PCSK6 maturation and secretion. RCN3 Protein, Mouse (HEK293, His) is the recombinant mouse-derived RCN3 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

RCN3 Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/rcn3-protein-mouse-hek293-his.html

Purity

98.0

Smiles

KPSPDAGPHGQDRVHHGTPLSEAPHDDAHGNFQYDHEAFLGRDVAKEFDKLSPEESQARLGRIVDRMDLAGDSDGWVSLAELRAWIAHTQQRHIRDSVSAAWHTYDTDRDGRVGWEELRNATYGHYEPGEEFHDVEDAETYKKMLARDERRFRVADQDGDSMATREELTAFLHPEEFPHMRDIVVAETLEDLDKNKDGYVQVEEYIADLYSEEPGEEEPAWVQTERQQFREFRDLNKDGRLDGSEVGYWVLPPSQDQPLVEANHLLHESDTDKDGRLSKAEILSNWNMFVGSQATNYGEDLTRHHDEL

Molecular Formula

52377 (Gene_ID) Q8BH97 (K21-L328) (Accession)

Molecular Weight

Approximately 48 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Wide Mouth Bottle, PP, sterile
21207-S 400 PCS/Carton

Wide Mouth Bottle, PP, sterile

Sign In for Pricing
View Details
Rabbit anti-Arabidopsis thaliana (Mouse-ear cress) MYB83 Polyclonal Antibody
MBS7147190 Inquire

Rabbit anti-Arabidopsis thaliana (Mouse-ear cress) MYB83 Polyclonal Antibody

Sign In for Pricing
View Details
Lentiviral human NIPA2 shRNA (UAS) - Lentiviral human NIPA2 shRNA (UAS, iRFP) plasmid
GTR15310603 1 Vial

Lentiviral human NIPA2 shRNA (UAS) - Lentiviral human NIPA2 shRNA (UAS, iRFP) plasmid

Sign In for Pricing
View Details
Phospho-Nucleolin (Thr84) Recombinant Antibody, PerCP Conjugated
bsm-62916R-PerCP 100 µL

Phospho-Nucleolin (Thr84) Recombinant Antibody, PerCP Conjugated

Sign In for Pricing
View Details
Recombinant Saccharophagus degradans Iron-sulfur cluster insertion protein ErpA (erpA)
MBS1374572-01 0.02 mg (E-Coli)

Recombinant Saccharophagus degradans Iron-sulfur cluster insertion protein ErpA (erpA)

Sign In for Pricing
View Details
Recombinant Saccharophagus degradans Iron-sulfur cluster insertion protein ErpA (erpA)
MBS1374572-02 0.1 mg (E-Coli)

Recombinant Saccharophagus degradans Iron-sulfur cluster insertion protein ErpA (erpA)

Sign In for Pricing
View Details