Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RCN3, Mouse (HEK293, His)

RCN3 Protein, a probable molecular chaperone, ensures pulmonary surfactant homeostasis by aiding in proper biosynthesis and transport of SP-A, SP-D, and ABCA3. It exhibits anti-fibrotic activity by negatively regulating type I and type III collagen secretion. RCN3 transiently associates with immature PCSK6, suggesting its role in PCSK6 maturation and secretion. RCN3 Protein, Mouse (HEK293, His) is the recombinant mouse-derived RCN3 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

RCN3 Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/rcn3-protein-mouse-hek293-his.html

Purity

98.0

Smiles

KPSPDAGPHGQDRVHHGTPLSEAPHDDAHGNFQYDHEAFLGRDVAKEFDKLSPEESQARLGRIVDRMDLAGDSDGWVSLAELRAWIAHTQQRHIRDSVSAAWHTYDTDRDGRVGWEELRNATYGHYEPGEEFHDVEDAETYKKMLARDERRFRVADQDGDSMATREELTAFLHPEEFPHMRDIVVAETLEDLDKNKDGYVQVEEYIADLYSEEPGEEEPAWVQTERQQFREFRDLNKDGRLDGSEVGYWVLPPSQDQPLVEANHLLHESDTDKDGRLSKAEILSNWNMFVGSQATNYGEDLTRHHDEL

Molecular Formula

52377 (Gene_ID) Q8BH97 (K21-L328) (Accession)

Molecular Weight

Approximately 48 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Chtop (NM_001293779) Mouse Tagged ORF Clone
MR228480 10 µg

Chtop (NM_001293779) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
TM2D2 Lentiviral Vector (Human) (UbC) (pLenti-GIII-UbC)
LV703423 1.0 µg DNA

TM2D2 Lentiviral Vector (Human) (UbC) (pLenti-GIII-UbC)

Sign In for Pricing
View Details
Rat Monoclonal CD300f/LMIR3/CD300LF Antibody (234903) [Janelia Fluor 635]
FAB2774JF635 0.1 mL

Rat Monoclonal CD300f/LMIR3/CD300LF Antibody (234903) [Janelia Fluor 635]

Sign In for Pricing
View Details
Nuclear RNA Export Factor 5 (NXF5) Antibody (Biotin)
abx304691-01 20 µg

Nuclear RNA Export Factor 5 (NXF5) Antibody (Biotin)

Sign In for Pricing
View Details
Nuclear RNA Export Factor 5 (NXF5) Antibody (Biotin)
abx304691-02 50 µg

Nuclear RNA Export Factor 5 (NXF5) Antibody (Biotin)

Sign In for Pricing
View Details
Nuclear RNA Export Factor 5 (NXF5) Antibody (Biotin)
abx304691-03 100 µg

Nuclear RNA Export Factor 5 (NXF5) Antibody (Biotin)

Sign In for Pricing
View Details