Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RCN3, Mouse (HEK293, His)

RCN3 Protein, a probable molecular chaperone, ensures pulmonary surfactant homeostasis by aiding in proper biosynthesis and transport of SP-A, SP-D, and ABCA3. It exhibits anti-fibrotic activity by negatively regulating type I and type III collagen secretion. RCN3 transiently associates with immature PCSK6, suggesting its role in PCSK6 maturation and secretion. RCN3 Protein, Mouse (HEK293, His) is the recombinant mouse-derived RCN3 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

RCN3 Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/rcn3-protein-mouse-hek293-his.html

Purity

98.0

Smiles

KPSPDAGPHGQDRVHHGTPLSEAPHDDAHGNFQYDHEAFLGRDVAKEFDKLSPEESQARLGRIVDRMDLAGDSDGWVSLAELRAWIAHTQQRHIRDSVSAAWHTYDTDRDGRVGWEELRNATYGHYEPGEEFHDVEDAETYKKMLARDERRFRVADQDGDSMATREELTAFLHPEEFPHMRDIVVAETLEDLDKNKDGYVQVEEYIADLYSEEPGEEEPAWVQTERQQFREFRDLNKDGRLDGSEVGYWVLPPSQDQPLVEANHLLHESDTDKDGRLSKAEILSNWNMFVGSQATNYGEDLTRHHDEL

Molecular Formula

52377 (Gene_ID) Q8BH97 (K21-L328) (Accession)

Molecular Weight

Approximately 48 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Imidacloprid-d4
TRC-I274992-25MG 25 mg

Imidacloprid-d4

Sign In for Pricing
View Details
C11orf71 (NM_019021) Human Recombinant Protein
PH31680E1 50 µg

C11orf71 (NM_019021) Human Recombinant Protein

Sign In for Pricing
View Details
CD162 (P-selectin Glycoprotein Ligand 1, PSGL-1, Selectin P Ligand, SELPLG) discontinued. see C7947-65B
C2548-89X 50 µg

CD162 (P-selectin Glycoprotein Ligand 1, PSGL-1, Selectin P Ligand, SELPLG) discontinued. see C7947-65B

Sign In for Pricing
View Details
RPL5P26 3'UTR Luciferase Stable Cell Line
TU020455 1.0 mL

RPL5P26 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Blood Agar Plates, w/ Chloramphenicol
30629059-5 80 Plates

Blood Agar Plates, w/ Chloramphenicol

Sign In for Pricing
View Details
Canine Glucoside xylosyltransferase 2,GXYLT2 ELISA KIT
JOT-EK0388Ca 96 wells

Canine Glucoside xylosyltransferase 2,GXYLT2 ELISA KIT

Sign In for Pricing
View Details