Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RCN3, Mouse (HEK293, His)

RCN3 Protein, a probable molecular chaperone, ensures pulmonary surfactant homeostasis by aiding in proper biosynthesis and transport of SP-A, SP-D, and ABCA3. It exhibits anti-fibrotic activity by negatively regulating type I and type III collagen secretion. RCN3 transiently associates with immature PCSK6, suggesting its role in PCSK6 maturation and secretion. RCN3 Protein, Mouse (HEK293, His) is the recombinant mouse-derived RCN3 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

RCN3 Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/rcn3-protein-mouse-hek293-his.html

Purity

98.0

Smiles

KPSPDAGPHGQDRVHHGTPLSEAPHDDAHGNFQYDHEAFLGRDVAKEFDKLSPEESQARLGRIVDRMDLAGDSDGWVSLAELRAWIAHTQQRHIRDSVSAAWHTYDTDRDGRVGWEELRNATYGHYEPGEEFHDVEDAETYKKMLARDERRFRVADQDGDSMATREELTAFLHPEEFPHMRDIVVAETLEDLDKNKDGYVQVEEYIADLYSEEPGEEEPAWVQTERQQFREFRDLNKDGRLDGSEVGYWVLPPSQDQPLVEANHLLHESDTDKDGRLSKAEILSNWNMFVGSQATNYGEDLTRHHDEL

Molecular Formula

52377 (Gene_ID) Q8BH97 (K21-L328) (Accession)

Molecular Weight

Approximately 48 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cat Leptin (LEP) ELISA Kit
SL0117Fe-01 48 Tests

Cat Leptin (LEP) ELISA Kit

Sign In for Pricing
View Details
Cat Leptin (LEP) ELISA Kit
SL0117Fe-02 96 Tests

Cat Leptin (LEP) ELISA Kit

Sign In for Pricing
View Details
SGOL2 (SGO2) Human shRNA Plasmid Kit (Locus ID 151246)
TL301730 1 Kit

SGOL2 (SGO2) Human shRNA Plasmid Kit (Locus ID 151246)

Sign In for Pricing
View Details
PFDN4, Recombinant, Human, aa1-134, His-Tag (Prefoldin Subunit 4, Protein C-1, PFD4)
351426-01 50 µg

PFDN4, Recombinant, Human, aa1-134, His-Tag (Prefoldin Subunit 4, Protein C-1, PFD4)

Sign In for Pricing
View Details
PFDN4, Recombinant, Human, aa1-134, His-Tag (Prefoldin Subunit 4, Protein C-1, PFD4)
351426-02 250 µg

PFDN4, Recombinant, Human, aa1-134, His-Tag (Prefoldin Subunit 4, Protein C-1, PFD4)

Sign In for Pricing
View Details
Dabigatran Acyl-β-D-Glucuronide TFA
MF-0147238-01 100 mg

Dabigatran Acyl-β-D-Glucuronide TFA

Sign In for Pricing
View Details