Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RCN3, Mouse (HEK293, His)

RCN3 Protein, a probable molecular chaperone, ensures pulmonary surfactant homeostasis by aiding in proper biosynthesis and transport of SP-A, SP-D, and ABCA3. It exhibits anti-fibrotic activity by negatively regulating type I and type III collagen secretion. RCN3 transiently associates with immature PCSK6, suggesting its role in PCSK6 maturation and secretion. RCN3 Protein, Mouse (HEK293, His) is the recombinant mouse-derived RCN3 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

RCN3 Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/rcn3-protein-mouse-hek293-his.html

Purity

98.0

Smiles

KPSPDAGPHGQDRVHHGTPLSEAPHDDAHGNFQYDHEAFLGRDVAKEFDKLSPEESQARLGRIVDRMDLAGDSDGWVSLAELRAWIAHTQQRHIRDSVSAAWHTYDTDRDGRVGWEELRNATYGHYEPGEEFHDVEDAETYKKMLARDERRFRVADQDGDSMATREELTAFLHPEEFPHMRDIVVAETLEDLDKNKDGYVQVEEYIADLYSEEPGEEEPAWVQTERQQFREFRDLNKDGRLDGSEVGYWVLPPSQDQPLVEANHLLHESDTDKDGRLSKAEILSNWNMFVGSQATNYGEDLTRHHDEL

Molecular Formula

52377 (Gene_ID) Q8BH97 (K21-L328) (Accession)

Molecular Weight

Approximately 48 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

CRISPLD1 Rabbit Polyclonal Antibody
TA358258 100 µL

CRISPLD1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
TPX2 (P100, C20orf1, C20orf2, DIL2, HCA519, p100, Protein FLS353, Hepatocellular carcinoma-associated antigen 519, Targeting protein for Xklp2, Restricted expression proliferation associated protein 100, Differentially expressed in cancerous and noncancer
MBS6120752-01 0.2 mL

TPX2 (P100, C20orf1, C20orf2, DIL2, HCA519, p100, Protein FLS353, Hepatocellular carcinoma-associated antigen 519, Targeting protein for Xklp2, Restricted expression proliferation associated protein 100, Differentially expressed in cancerous and noncancer

Sign In for Pricing
View Details
TPX2 (P100, C20orf1, C20orf2, DIL2, HCA519, p100, Protein FLS353, Hepatocellular carcinoma-associated antigen 519, Targeting protein for Xklp2, Restricted expression proliferation associated protein 100, Differentially expressed in cancerous and noncancer
MBS6120752-02 5x 0.2 mL

TPX2 (P100, C20orf1, C20orf2, DIL2, HCA519, p100, Protein FLS353, Hepatocellular carcinoma-associated antigen 519, Targeting protein for Xklp2, Restricted expression proliferation associated protein 100, Differentially expressed in cancerous and noncancer

Sign In for Pricing
View Details
Rat Caspase 12 (CASP12) CLIA Kit
abx196787 96 Tests

Rat Caspase 12 (CASP12) CLIA Kit

Sign In for Pricing
View Details
Sgce (NM_001002023) Rat Tagged ORF Clone Lentiviral Particle
RR203982L3V 200 µL

Sgce (NM_001002023) Rat Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Metoclopramide N-Oxide
017596 25 mg

Metoclopramide N-Oxide

Sign In for Pricing
View Details