Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RCN3, Mouse (HEK293, His)

RCN3 Protein, a probable molecular chaperone, ensures pulmonary surfactant homeostasis by aiding in proper biosynthesis and transport of SP-A, SP-D, and ABCA3. It exhibits anti-fibrotic activity by negatively regulating type I and type III collagen secretion. RCN3 transiently associates with immature PCSK6, suggesting its role in PCSK6 maturation and secretion. RCN3 Protein, Mouse (HEK293, His) is the recombinant mouse-derived RCN3 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

RCN3 Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/rcn3-protein-mouse-hek293-his.html

Purity

98.0

Smiles

KPSPDAGPHGQDRVHHGTPLSEAPHDDAHGNFQYDHEAFLGRDVAKEFDKLSPEESQARLGRIVDRMDLAGDSDGWVSLAELRAWIAHTQQRHIRDSVSAAWHTYDTDRDGRVGWEELRNATYGHYEPGEEFHDVEDAETYKKMLARDERRFRVADQDGDSMATREELTAFLHPEEFPHMRDIVVAETLEDLDKNKDGYVQVEEYIADLYSEEPGEEEPAWVQTERQQFREFRDLNKDGRLDGSEVGYWVLPPSQDQPLVEANHLLHESDTDKDGRLSKAEILSNWNMFVGSQATNYGEDLTRHHDEL

Molecular Formula

52377 (Gene_ID) Q8BH97 (K21-L328) (Accession)

Molecular Weight

Approximately 48 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

CYP2D6 polyclonal antibody
BS75115-01 50 µL

CYP2D6 polyclonal antibody

Sign In for Pricing
View Details
CYP2D6 polyclonal antibody
BS75115-02 100 µL

CYP2D6 polyclonal antibody

Sign In for Pricing
View Details
TCHP (NM_032300) Human 3' UTR Clone
SC214702 10 µg

TCHP (NM_032300) Human 3' UTR Clone

Sign In for Pricing
View Details
PCBP3 Peptide
abx616733 100 µg

PCBP3 Peptide

Sign In for Pricing
View Details
SV2B (NM_014848) Human Over-expression Lysate
LH18114V 100 µg

SV2B (NM_014848) Human Over-expression Lysate

Sign In for Pricing
View Details
Thielocin B1
MF-0044377 25 mg

Thielocin B1

Sign In for Pricing
View Details