Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RCN3, Mouse (HEK293, His)

RCN3 Protein, a probable molecular chaperone, ensures pulmonary surfactant homeostasis by aiding in proper biosynthesis and transport of SP-A, SP-D, and ABCA3. It exhibits anti-fibrotic activity by negatively regulating type I and type III collagen secretion. RCN3 transiently associates with immature PCSK6, suggesting its role in PCSK6 maturation and secretion. RCN3 Protein, Mouse (HEK293, His) is the recombinant mouse-derived RCN3 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

RCN3 Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/rcn3-protein-mouse-hek293-his.html

Purity

98.0

Smiles

KPSPDAGPHGQDRVHHGTPLSEAPHDDAHGNFQYDHEAFLGRDVAKEFDKLSPEESQARLGRIVDRMDLAGDSDGWVSLAELRAWIAHTQQRHIRDSVSAAWHTYDTDRDGRVGWEELRNATYGHYEPGEEFHDVEDAETYKKMLARDERRFRVADQDGDSMATREELTAFLHPEEFPHMRDIVVAETLEDLDKNKDGYVQVEEYIADLYSEEPGEEEPAWVQTERQQFREFRDLNKDGRLDGSEVGYWVLPPSQDQPLVEANHLLHESDTDKDGRLSKAEILSNWNMFVGSQATNYGEDLTRHHDEL

Molecular Formula

52377 (Gene_ID) Q8BH97 (K21-L328) (Accession)

Molecular Weight

Approximately 48 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Znhit1 (NM_027318) Mouse Tagged ORF Clone Lentiviral Particle
MR222712L3V 200 µL

Znhit1 (NM_027318) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Clathrin heavy chain (CLTC) (NM_004859) Human Untagged Clone
SC117104 10 µg

Clathrin heavy chain (CLTC) (NM_004859) Human Untagged Clone

Sign In for Pricing
View Details
Recombinant Candida Albicans YPI1 Protein (aa 1-124)
VAng-Lsx06074-1mgEcoli 1 mg (E. coli)

Recombinant Candida Albicans YPI1 Protein (aa 1-124)

Sign In for Pricing
View Details
UST, CT (UST, DS2ST, Uronyl 2-sulfotransferase) (MaxLight 550)
MBS6362033-01 0.1 mL

UST, CT (UST, DS2ST, Uronyl 2-sulfotransferase) (MaxLight 550)

Sign In for Pricing
View Details
UST, CT (UST, DS2ST, Uronyl 2-sulfotransferase) (MaxLight 550)
MBS6362033-02 5x 0.1 mL

UST, CT (UST, DS2ST, Uronyl 2-sulfotransferase) (MaxLight 550)

Sign In for Pricing
View Details
FITC anti-human CD19
GT16297 25 Tests

FITC anti-human CD19

Sign In for Pricing
View Details