Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RCN3, Mouse (HEK293, His)

RCN3 Protein, a probable molecular chaperone, ensures pulmonary surfactant homeostasis by aiding in proper biosynthesis and transport of SP-A, SP-D, and ABCA3. It exhibits anti-fibrotic activity by negatively regulating type I and type III collagen secretion. RCN3 transiently associates with immature PCSK6, suggesting its role in PCSK6 maturation and secretion. RCN3 Protein, Mouse (HEK293, His) is the recombinant mouse-derived RCN3 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

RCN3 Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/rcn3-protein-mouse-hek293-his.html

Purity

98.0

Smiles

KPSPDAGPHGQDRVHHGTPLSEAPHDDAHGNFQYDHEAFLGRDVAKEFDKLSPEESQARLGRIVDRMDLAGDSDGWVSLAELRAWIAHTQQRHIRDSVSAAWHTYDTDRDGRVGWEELRNATYGHYEPGEEFHDVEDAETYKKMLARDERRFRVADQDGDSMATREELTAFLHPEEFPHMRDIVVAETLEDLDKNKDGYVQVEEYIADLYSEEPGEEEPAWVQTERQQFREFRDLNKDGRLDGSEVGYWVLPPSQDQPLVEANHLLHESDTDKDGRLSKAEILSNWNMFVGSQATNYGEDLTRHHDEL

Molecular Formula

52377 (Gene_ID) Q8BH97 (K21-L328) (Accession)

Molecular Weight

Approximately 48 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human APOBEC4 shRNA (UAS) - Lentiviral human APOBEC4 shRNA (UAS) (100)
GTR15082806 1 Vial

Lentiviral human APOBEC4 shRNA (UAS) - Lentiviral human APOBEC4 shRNA (UAS) (100)

Sign In for Pricing
View Details
INPP1 (HRP)
565747-01 50 µg

INPP1 (HRP)

Sign In for Pricing
View Details
INPP1 (HRP)
565747-02 100 µg

INPP1 (HRP)

Sign In for Pricing
View Details
RGD1307595 ORF Vector (Rat) (pORF)
ORF074858 1.0 µg DNA

RGD1307595 ORF Vector (Rat) (pORF)

Sign In for Pricing
View Details
Sulpiride Impurity 19
RM-S161842-01 10 mg

Sulpiride Impurity 19

Sign In for Pricing
View Details
Sulpiride Impurity 19
RM-S161842-02 25 mg

Sulpiride Impurity 19

Sign In for Pricing
View Details