Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RCN3, Mouse (HEK293, His)

RCN3 Protein, a probable molecular chaperone, ensures pulmonary surfactant homeostasis by aiding in proper biosynthesis and transport of SP-A, SP-D, and ABCA3. It exhibits anti-fibrotic activity by negatively regulating type I and type III collagen secretion. RCN3 transiently associates with immature PCSK6, suggesting its role in PCSK6 maturation and secretion. RCN3 Protein, Mouse (HEK293, His) is the recombinant mouse-derived RCN3 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

RCN3 Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/rcn3-protein-mouse-hek293-his.html

Purity

98.0

Smiles

KPSPDAGPHGQDRVHHGTPLSEAPHDDAHGNFQYDHEAFLGRDVAKEFDKLSPEESQARLGRIVDRMDLAGDSDGWVSLAELRAWIAHTQQRHIRDSVSAAWHTYDTDRDGRVGWEELRNATYGHYEPGEEFHDVEDAETYKKMLARDERRFRVADQDGDSMATREELTAFLHPEEFPHMRDIVVAETLEDLDKNKDGYVQVEEYIADLYSEEPGEEEPAWVQTERQQFREFRDLNKDGRLDGSEVGYWVLPPSQDQPLVEANHLLHESDTDKDGRLSKAEILSNWNMFVGSQATNYGEDLTRHHDEL

Molecular Formula

52377 (Gene_ID) Q8BH97 (K21-L328) (Accession)

Molecular Weight

Approximately 48 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Cyb561d2 shRNA (UAS) - Lentiviral mouse Cyb561d2 shRNA (UAS, GFP) (100)
GTR15220953 1 Vial

Lentiviral mouse Cyb561d2 shRNA (UAS) - Lentiviral mouse Cyb561d2 shRNA (UAS, GFP) (100)

Sign In for Pricing
View Details
Gremlin-1 (C-7) Alexa Fluor® 546
sc-515877 AF546 200 µg/mL

Gremlin-1 (C-7) Alexa Fluor® 546

Sign In for Pricing
View Details
Bacterial Genomic DNA Isolation Kit
PI-0109 100 Well

Bacterial Genomic DNA Isolation Kit

Sign In for Pricing
View Details
Mid1ip1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)
K3515508 1.0 µg DNA

Mid1ip1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)

Sign In for Pricing
View Details
Rabbit Anti-Human ATG2A Polyclonal
MBS807396-01 0.1 mg

Rabbit Anti-Human ATG2A Polyclonal

Sign In for Pricing
View Details
Rabbit Anti-Human ATG2A Polyclonal
MBS807396-02 5x 0.1 mg

Rabbit Anti-Human ATG2A Polyclonal

Sign In for Pricing
View Details