Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RCN3, Mouse (HEK293, His)

RCN3 Protein, a probable molecular chaperone, ensures pulmonary surfactant homeostasis by aiding in proper biosynthesis and transport of SP-A, SP-D, and ABCA3. It exhibits anti-fibrotic activity by negatively regulating type I and type III collagen secretion. RCN3 transiently associates with immature PCSK6, suggesting its role in PCSK6 maturation and secretion. RCN3 Protein, Mouse (HEK293, His) is the recombinant mouse-derived RCN3 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

RCN3 Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/rcn3-protein-mouse-hek293-his.html

Purity

98.0

Smiles

KPSPDAGPHGQDRVHHGTPLSEAPHDDAHGNFQYDHEAFLGRDVAKEFDKLSPEESQARLGRIVDRMDLAGDSDGWVSLAELRAWIAHTQQRHIRDSVSAAWHTYDTDRDGRVGWEELRNATYGHYEPGEEFHDVEDAETYKKMLARDERRFRVADQDGDSMATREELTAFLHPEEFPHMRDIVVAETLEDLDKNKDGYVQVEEYIADLYSEEPGEEEPAWVQTERQQFREFRDLNKDGRLDGSEVGYWVLPPSQDQPLVEANHLLHESDTDKDGRLSKAEILSNWNMFVGSQATNYGEDLTRHHDEL

Molecular Formula

52377 (Gene_ID) Q8BH97 (K21-L328) (Accession)

Molecular Weight

Approximately 48 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

MHC Class II RT1B (monomorphic) Mouse Monoclonal Antibody [Clone ID: OX-6]
SM084R 100 Tests

MHC Class II RT1B (monomorphic) Mouse Monoclonal Antibody [Clone ID: OX-6]

Sign In for Pricing
View Details
MYH15 Human shRNA Plasmid Kit (Locus ID 22989)
TL321442 1 Kit

MYH15 Human shRNA Plasmid Kit (Locus ID 22989)

Sign In for Pricing
View Details
Med15 (NM_001285884) Mouse Tagged ORF Clone
MR231099 10 µg

Med15 (NM_001285884) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Gfi1b sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)
K6403305 3x 1.0 µg

Gfi1b sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)

Sign In for Pricing
View Details
ITGA10 Protein Vector (Human) (pPB-N-His)
PV088031 500 ng

ITGA10 Protein Vector (Human) (pPB-N-His)

Sign In for Pricing
View Details
Rad51D Recombinant Antibody, PE-Cy7 Conjugated
bsm-61028R-PE-Cy7-01 20 µL

Rad51D Recombinant Antibody, PE-Cy7 Conjugated

Sign In for Pricing
View Details