Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RCN3, Mouse (HEK293, His)

RCN3 Protein, a probable molecular chaperone, ensures pulmonary surfactant homeostasis by aiding in proper biosynthesis and transport of SP-A, SP-D, and ABCA3. It exhibits anti-fibrotic activity by negatively regulating type I and type III collagen secretion. RCN3 transiently associates with immature PCSK6, suggesting its role in PCSK6 maturation and secretion. RCN3 Protein, Mouse (HEK293, His) is the recombinant mouse-derived RCN3 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

RCN3 Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/rcn3-protein-mouse-hek293-his.html

Purity

98.0

Smiles

KPSPDAGPHGQDRVHHGTPLSEAPHDDAHGNFQYDHEAFLGRDVAKEFDKLSPEESQARLGRIVDRMDLAGDSDGWVSLAELRAWIAHTQQRHIRDSVSAAWHTYDTDRDGRVGWEELRNATYGHYEPGEEFHDVEDAETYKKMLARDERRFRVADQDGDSMATREELTAFLHPEEFPHMRDIVVAETLEDLDKNKDGYVQVEEYIADLYSEEPGEEEPAWVQTERQQFREFRDLNKDGRLDGSEVGYWVLPPSQDQPLVEANHLLHESDTDKDGRLSKAEILSNWNMFVGSQATNYGEDLTRHHDEL

Molecular Formula

52377 (Gene_ID) Q8BH97 (K21-L328) (Accession)

Molecular Weight

Approximately 48 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Adenovirus (ADV)
226828 200 µg

Adenovirus (ADV)

Sign In for Pricing
View Details
Cldnd1 Rat shRNA Lentiviral Particle (Locus ID 288182)
TL700717V 500 µL Each

Cldnd1 Rat shRNA Lentiviral Particle (Locus ID 288182)

Sign In for Pricing
View Details
Sambucus nigra Lectin (SNA/EBL I) - Separopore® 4B
20120066-1 2 mL

Sambucus nigra Lectin (SNA/EBL I) - Separopore® 4B

Sign In for Pricing
View Details
C9orf72 Human shRNA Plasmid Kit (Locus ID 203228)
TR305711 1 Kit

C9orf72 Human shRNA Plasmid Kit (Locus ID 203228)

Sign In for Pricing
View Details
Mouse Kinesin 2 ELISA Kit
MBS049847-01 48 Well

Mouse Kinesin 2 ELISA Kit

Sign In for Pricing
View Details
Mouse Kinesin 2 ELISA Kit
MBS049847-02 96 Well

Mouse Kinesin 2 ELISA Kit

Sign In for Pricing
View Details